BLASTX nr result
ID: Rehmannia30_contig00029068
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00029068 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073190.1| pentatricopeptide repeat-containing protein ... 109 7e-25 gb|KZV21767.1| pentatricopeptide repeat-containing protein mitoc... 108 1e-24 gb|EYU21818.1| hypothetical protein MIMGU_mgv1a0008301mg, partia... 92 7e-19 ref|XP_012856170.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-19 ref|XP_022884898.1| pentatricopeptide repeat-containing protein ... 92 8e-19 ref|XP_016479191.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-11 ref|XP_009628319.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-11 ref|XP_019243407.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-11 ref|XP_009802105.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-11 emb|CDP19762.1| unnamed protein product [Coffea canephora] 70 3e-11 gb|EPS65114.1| hypothetical protein M569_09664 [Genlisea aurea] 67 6e-10 ref|XP_019169899.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 gb|PHU24206.1| hypothetical protein BC332_09313 [Capsicum chinense] 58 9e-07 gb|KZM91229.1| hypothetical protein DCAR_021406 [Daucus carota s... 57 1e-06 ref|XP_017258264.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 gb|PHT49861.1| hypothetical protein CQW23_09608 [Capsicum baccatum] 57 1e-06 ref|XP_016563062.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_018824875.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|OVA17376.1| Pentatricopeptide repeat [Macleaya cordata] 56 4e-06 >ref|XP_011073190.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] ref|XP_020548519.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] ref|XP_020548520.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] ref|XP_020548521.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] Length = 1035 Score = 109 bits (273), Expect = 7e-25 Identities = 55/89 (61%), Positives = 68/89 (76%), Gaps = 8/89 (8%) Frame = +3 Query: 213 MVKLLSPKYCTLILX--------RLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQY 368 MV++ SPK LI RLLC+S+KS+QYS SP ++EATA EI KILKHN+WQ+ Sbjct: 1 MVQVFSPKASILIRCQQGLIKKTRLLCISVKSQQYSRSPAENEATAAEIDKILKHNNWQF 60 Query: 369 LLESSHIPQGLNPNVVHSVLQKTQFSIHP 455 LLESSHIPQ LN +VVHSVLQ++ FS+HP Sbjct: 61 LLESSHIPQRLNADVVHSVLQRSNFSVHP 89 >gb|KZV21767.1| pentatricopeptide repeat-containing protein mitochondrial-like [Dorcoceras hygrometricum] Length = 1488 Score = 108 bits (271), Expect = 1e-24 Identities = 56/90 (62%), Positives = 68/90 (75%), Gaps = 8/90 (8%) Frame = +3 Query: 210 KMVKLLSPKYCTLILX--------RLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQ 365 KMV L SP C + + RLLCV+IKSR+YSHSP + E TA EIT+ILKHN+WQ Sbjct: 541 KMVPLFSPGGCNMGIYERQLIKKIRLLCVTIKSRRYSHSPGEIEVTAAEITRILKHNNWQ 600 Query: 366 YLLESSHIPQGLNPNVVHSVLQKTQFSIHP 455 +LLESSHIPQ LN +VV++VLQ+T FSIHP Sbjct: 601 FLLESSHIPQRLNYDVVNTVLQRTHFSIHP 630 >gb|EYU21818.1| hypothetical protein MIMGU_mgv1a0008301mg, partial [Erythranthe guttata] Length = 828 Score = 92.4 bits (228), Expect = 7e-19 Identities = 51/84 (60%), Positives = 64/84 (76%), Gaps = 3/84 (3%) Frame = +3 Query: 213 MVKLLSPKYCTLILX-RLLCVSIKSRQYSHSPPK-SEATAEEITKIL-KHNSWQYLLESS 383 MV+L SP+ T I RLL SIKS+QY H+PP +EATAEEI ++L KHN+WQ+LLESS Sbjct: 1 MVQLFSPRIRTTIKKSRLLFASIKSQQYCHTPPPHTEATAEEIIRVLSKHNNWQFLLESS 60 Query: 384 HIPQGLNPNVVHSVLQKTQFSIHP 455 HIP L+ +VV SVLQ++ FS HP Sbjct: 61 HIPTKLSSDVVQSVLQRSHFSTHP 84 >ref|XP_012856170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial, partial [Erythranthe guttata] Length = 835 Score = 92.4 bits (228), Expect = 7e-19 Identities = 51/84 (60%), Positives = 64/84 (76%), Gaps = 3/84 (3%) Frame = +3 Query: 213 MVKLLSPKYCTLILX-RLLCVSIKSRQYSHSPPK-SEATAEEITKIL-KHNSWQYLLESS 383 MV+L SP+ T I RLL SIKS+QY H+PP +EATAEEI ++L KHN+WQ+LLESS Sbjct: 1 MVQLFSPRIRTTIKKSRLLFASIKSQQYCHTPPPHTEATAEEIIRVLSKHNNWQFLLESS 60 Query: 384 HIPQGLNPNVVHSVLQKTQFSIHP 455 HIP L+ +VV SVLQ++ FS HP Sbjct: 61 HIPTKLSSDVVQSVLQRSHFSTHP 84 >ref|XP_022884898.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Olea europaea var. sylvestris] ref|XP_022884899.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Olea europaea var. sylvestris] Length = 1027 Score = 92.4 bits (228), Expect = 8e-19 Identities = 51/89 (57%), Positives = 62/89 (69%), Gaps = 8/89 (8%) Frame = +3 Query: 213 MVKLLSPKYCTLILX--------RLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQY 368 M+ L S K CTL + R LCVS+KS Q S ++EAT EITKILKH++W+Y Sbjct: 1 MIILFSNKACTLFIKQHRIINKTRHLCVSVKSDQISE---ENEATIAEITKILKHHNWKY 57 Query: 369 LLESSHIPQGLNPNVVHSVLQKTQFSIHP 455 LLESSHIPQ +N V+HSVLQ+T FSIHP Sbjct: 58 LLESSHIPQRINNVVMHSVLQRTDFSIHP 86 >ref|XP_016479191.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tabacum] ref|XP_016479192.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tabacum] Length = 921 Score = 71.6 bits (174), Expect = 1e-11 Identities = 34/78 (43%), Positives = 56/78 (71%) Frame = +3 Query: 222 LLSPKYCTLILXRLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGL 401 LLS + + R + I+SR++++ P ++++TAEEI+ +LKH +W +LLESS IPQ L Sbjct: 4 LLSKQAFVIKKARHVSFCIESRRFANIPGENKSTAEEISALLKHKNWNFLLESSGIPQKL 63 Query: 402 NPNVVHSVLQKTQFSIHP 455 +P+VVHSVL + + ++P Sbjct: 64 SPDVVHSVLDRNKLVVNP 81 >ref|XP_009628319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tomentosiformis] ref|XP_009628320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tomentosiformis] Length = 921 Score = 71.6 bits (174), Expect = 1e-11 Identities = 34/78 (43%), Positives = 56/78 (71%) Frame = +3 Query: 222 LLSPKYCTLILXRLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGL 401 LLS + + R + I+SR++++ P ++++TAEEI+ +LKH +W +LLESS IPQ L Sbjct: 4 LLSKQAFVIKKARHVSFCIESRRFANIPGENKSTAEEISALLKHKNWNFLLESSGIPQKL 63 Query: 402 NPNVVHSVLQKTQFSIHP 455 +P+VVHSVL + + ++P Sbjct: 64 SPDVVHSVLDRNKLVVNP 81 >ref|XP_019243407.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana attenuata] ref|XP_019243408.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana attenuata] gb|OIT04662.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 921 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/78 (42%), Positives = 55/78 (70%) Frame = +3 Query: 222 LLSPKYCTLILXRLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGL 401 LLS + + R + I++R++++ P + ++TAEEI+ +LKH +W +LLESS IPQ L Sbjct: 4 LLSKQAIVIKKARHVSFCIEARRFANIPGEKKSTAEEISALLKHKNWNFLLESSEIPQKL 63 Query: 402 NPNVVHSVLQKTQFSIHP 455 +P+VVHSVL + + ++P Sbjct: 64 SPDVVHSVLDRNKLVVNP 81 >ref|XP_009802105.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana sylvestris] ref|XP_016464841.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tabacum] Length = 921 Score = 70.5 bits (171), Expect = 3e-11 Identities = 33/78 (42%), Positives = 54/78 (69%) Frame = +3 Query: 222 LLSPKYCTLILXRLLCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGL 401 LLS + + R + I+ R++++ P + ++TAEEI+ +LKH +W +LLESS IPQ L Sbjct: 4 LLSKRTFVIKKARHVSFCIEPRRFANIPGEKKSTAEEISALLKHKNWNFLLESSEIPQKL 63 Query: 402 NPNVVHSVLQKTQFSIHP 455 +P+VVHSVL + + ++P Sbjct: 64 SPDVVHSVLDRNKLVVNP 81 >emb|CDP19762.1| unnamed protein product [Coffea canephora] Length = 1035 Score = 70.5 bits (171), Expect = 3e-11 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 291 YSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQ-GLNPNVVHSVLQKTQFSIHP 455 + H+ +E+TAEEI+KIL HN+WQ+LLESS +PQ LNP+VV SVLQ+ Q IHP Sbjct: 35 FFHTSRGNESTAEEISKILMHNNWQFLLESSTVPQEKLNPDVVQSVLQRNQLDIHP 90 >gb|EPS65114.1| hypothetical protein M569_09664 [Genlisea aurea] Length = 1012 Score = 67.0 bits (162), Expect = 6e-10 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 5/86 (5%) Frame = +3 Query: 213 MVKLLSPKYCTLILXRL-----LCVSIKSRQYSHSPPKSEATAEEITKILKHNSWQYLLE 377 M +LLSP C + + +S+ R YS+ SEA EI KILKHN+W+++L+ Sbjct: 1 MARLLSPASCIFRQGMIGETGFMFISVSFRLYSNGVSVSEAA--EIGKILKHNNWEFMLD 58 Query: 378 SSHIPQGLNPNVVHSVLQKTQFSIHP 455 SS IP LN VV SVLQ T S+HP Sbjct: 59 SSDIPLHLNSEVVDSVLQGTHSSVHP 84 >ref|XP_019169899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] ref|XP_019169900.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] ref|XP_019169901.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] Length = 1031 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/63 (44%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = +3 Query: 270 VSIKSRQ-YSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVLQKTQFS 446 V+++SR+ + + ++E AE+I+KIL NSW+ LL+SS +P LNP+VV+SVL +++ Sbjct: 23 VTLRSRRRFLCTATENEVAAEDISKILGLNSWELLLDSSAVPSKLNPDVVYSVLHRSRSV 82 Query: 447 IHP 455 +HP Sbjct: 83 VHP 85 >gb|PHU24206.1| hypothetical protein BC332_09313 [Capsicum chinense] Length = 1023 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/54 (50%), Positives = 40/54 (74%) Frame = +3 Query: 294 SHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVLQKTQFSIHP 455 S S +++TAEEI+ ILKH +W+ LL SS IPQ +NP+VV+SVL + + ++P Sbjct: 30 SISGVSNKSTAEEISTILKHKNWKLLLGSSEIPQKINPDVVYSVLDRNKLVVNP 83 >gb|KZM91229.1| hypothetical protein DCAR_021406 [Daucus carota subsp. sativus] Length = 846 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +3 Query: 282 SRQYSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVL 428 +R +SH+ +AT EITKILKHN+W++ LESS+IP+ LNP+V+ SVL Sbjct: 20 TRFFSHN---EDATIGEITKILKHNNWKFYLESSNIPRKLNPDVIPSVL 65 >ref|XP_017258264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Daucus carota subsp. sativus] ref|XP_017258266.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Daucus carota subsp. sativus] Length = 1015 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +3 Query: 282 SRQYSHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVL 428 +R +SH+ +AT EITKILKHN+W++ LESS+IP+ LNP+V+ SVL Sbjct: 22 TRFFSHN---EDATIGEITKILKHNNWKFYLESSNIPRKLNPDVIPSVL 67 >gb|PHT49861.1| hypothetical protein CQW23_09608 [Capsicum baccatum] Length = 1023 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = +3 Query: 312 SEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVLQKTQFSIHP 455 +++TAEEI+ ILKH +W+ LL SS IPQ +NP+VV+SVL + + ++P Sbjct: 36 NKSTAEEISTILKHKNWKLLLGSSEIPQKINPDVVYSVLDRNKLVVNP 83 >ref|XP_016563062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Capsicum annuum] gb|PHT88573.1| hypothetical protein T459_10679 [Capsicum annuum] Length = 1023 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = +3 Query: 312 SEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVLQKTQFSIHP 455 +++TAEEI+ ILKH +W+ LL SS IPQ +NP+VV+SVL + + ++P Sbjct: 36 NKSTAEEISTILKHKNWKMLLGSSEIPQKINPDVVYSVLDRNKLVVNP 83 >ref|XP_018824875.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Juglans regia] Length = 940 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = +3 Query: 258 RLLCVSIKSRQY---SHSPPKSEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVL 428 RLL V KS + S E T EEI+ LK ++WQYL+ESS+IP+ LNP VV SVL Sbjct: 27 RLLFVYAKSFSFCTSQTSKQNEELTIEEISAFLKQSNWQYLMESSNIPKKLNPEVVRSVL 86 Query: 429 Q 431 Q Sbjct: 87 Q 87 >gb|OVA17376.1| Pentatricopeptide repeat [Macleaya cordata] Length = 1041 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/61 (42%), Positives = 42/61 (68%), Gaps = 3/61 (4%) Frame = +3 Query: 273 SIKSRQYSHSPPK---SEATAEEITKILKHNSWQYLLESSHIPQGLNPNVVHSVLQKTQF 443 S+K ++ S P +E +A EI+ +LKH++WQ+L++SS IP+ LNP ++ SVL + Q Sbjct: 26 SLKFMEFYSSQPSIKGNEESAREISNLLKHDNWQFLMDSSDIPKKLNPEIIRSVLLQNQV 85 Query: 444 S 446 S Sbjct: 86 S 86