BLASTX nr result
ID: Rehmannia30_contig00028368
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028368 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27964.1| hypothetical protein MIMGU_mgv1a014443mg [Erythra... 73 3e-13 ref|XP_012848816.1| PREDICTED: stem-specific protein TSJT1-like ... 73 9e-13 gb|PIN19737.1| hypothetical protein CDL12_07585 [Handroanthus im... 67 1e-10 ref|XP_011096293.1| stem-specific protein TSJT1 [Sesamum indicum] 63 6e-09 ref|XP_022845943.1| stem-specific protein TSJT1-like [Olea europ... 59 2e-07 ref|XP_022893741.1| stem-specific protein TSJT1-like [Olea europ... 57 1e-06 >gb|EYU27964.1| hypothetical protein MIMGU_mgv1a014443mg [Erythranthe guttata] Length = 189 Score = 73.2 bits (178), Expect = 3e-13 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 124 MLAVFEKLIGKPPKELSLPAVGRDCLNISPEEIAELFRSWR 2 MLAVFEK IGKPP ELSLPAVGR CLN SPEEIAE FRSWR Sbjct: 1 MLAVFEKSIGKPPIELSLPAVGRKCLNGSPEEIAETFRSWR 41 >ref|XP_012848816.1| PREDICTED: stem-specific protein TSJT1-like [Erythranthe guttata] Length = 255 Score = 73.2 bits (178), Expect = 9e-13 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 124 MLAVFEKLIGKPPKELSLPAVGRDCLNISPEEIAELFRSWR 2 MLAVFEK IGKPP ELSLPAVGR CLN SPEEIAE FRSWR Sbjct: 1 MLAVFEKSIGKPPIELSLPAVGRKCLNGSPEEIAETFRSWR 41 >gb|PIN19737.1| hypothetical protein CDL12_07585 [Handroanthus impetiginosus] Length = 254 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -2 Query: 124 MLAVFEKLIGKPPKELSLPAVGRDCLNISPEEIAELFRSWR 2 MLAVF K IGKPPKELSLP G +C N SP+EIAE+FRSWR Sbjct: 1 MLAVFNKSIGKPPKELSLPVAGGNCSNSSPQEIAEVFRSWR 41 >ref|XP_011096293.1| stem-specific protein TSJT1 [Sesamum indicum] Length = 253 Score = 62.8 bits (151), Expect = 6e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 124 MLAVFEKLIGKPPKELSLPAVGRDCLNISPEEIAELFRSWR 2 MLAVFE+ I PPKELSLP VGR+ LN SPEEIAE+FRSWR Sbjct: 1 MLAVFERSIANPPKELSLP-VGRNHLNSSPEEIAEIFRSWR 40 >ref|XP_022845943.1| stem-specific protein TSJT1-like [Olea europaea var. sylvestris] Length = 254 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 124 MLAVFEKLIGKPPKELSLPAVGRDCLNISPEEIAELFRSWR 2 MLAVFEK IGKPPKEL LP G+ LN S EEIAE++R WR Sbjct: 1 MLAVFEKSIGKPPKELILPFRGKSHLNSSREEIAEIYRLWR 41 >ref|XP_022893741.1| stem-specific protein TSJT1-like [Olea europaea var. sylvestris] Length = 254 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -2 Query: 124 MLAVFEKLIGKPPKELSLPAVGRDCLNISPEEIAELFRSWR 2 ML VFEK IGKPP+ELSLP G L + +EIAE+FRSWR Sbjct: 1 MLTVFEKSIGKPPQELSLPLAGSSGLKNTRQEIAEIFRSWR 41