BLASTX nr result
ID: Rehmannia30_contig00028360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028360 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022845881.1| uncharacterized protein LOC111368705 [Olea e... 60 2e-09 gb|KZV58293.1| hypothetical protein F511_01144 [Dorcoceras hygro... 60 6e-09 gb|PIM99414.1| hypothetical protein CDL12_28101 [Handroanthus im... 59 7e-09 ref|XP_012827424.1| PREDICTED: uncharacterized protein LOC105948... 59 9e-09 ref|XP_022988565.1| uncharacterized protein LOC111485766 [Cucurb... 56 1e-07 ref|XP_022942625.1| uncharacterized protein LOC111447607 [Cucurb... 56 1e-07 ref|XP_022139122.1| uncharacterized protein LOC111010108 [Momord... 55 4e-07 ref|XP_008445862.1| PREDICTED: uncharacterized protein LOC103488... 54 5e-07 ref|XP_004143612.1| PREDICTED: uncharacterized protein LOC101203... 54 5e-07 ref|XP_012073999.1| uncharacterized protein LOC105635544 [Jatrop... 54 5e-07 ref|XP_015571845.1| PREDICTED: uncharacterized protein LOC107260... 54 6e-07 ref|XP_019057867.1| PREDICTED: uncharacterized protein LOC109116... 54 7e-07 gb|KCW77221.1| hypothetical protein EUGRSUZ_D01574 [Eucalyptus g... 54 7e-07 ref|XP_013584841.1| PREDICTED: uncharacterized protein LOC106293... 54 1e-06 ref|XP_021678772.1| uncharacterized protein LOC110663689 [Hevea ... 54 1e-06 gb|OAY54460.1| hypothetical protein MANES_03G076700 [Manihot esc... 54 1e-06 emb|CDP17595.1| unnamed protein product [Coffea canephora] 54 2e-06 gb|KCW73501.1| hypothetical protein EUGRSUZ_E02008 [Eucalyptus g... 53 2e-06 ref|XP_004491614.1| PREDICTED: uncharacterized protein LOC101489... 53 2e-06 ref|XP_003519680.1| PREDICTED: uncharacterized protein LOC100803... 53 2e-06 >ref|XP_022845881.1| uncharacterized protein LOC111368705 [Olea europaea var. sylvestris] Length = 72 Score = 60.5 bits (145), Expect = 2e-09 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQE+YTNAQVFGAP PPPGS Sbjct: 22 CYFLGRAKGRQEVYTNAQVFGAPVPPPGS 50 >gb|KZV58293.1| hypothetical protein F511_01144 [Dorcoceras hygrometricum] Length = 86 Score = 59.7 bits (143), Expect = 6e-09 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSV 196 C+LFGRAKGR+E+YTN QVFG P PPPGSV Sbjct: 22 CFLFGRAKGRREVYTNTQVFGVPTPPPGSV 51 >gb|PIM99414.1| hypothetical protein CDL12_28101 [Handroanthus impetiginosus] Length = 74 Score = 59.3 bits (142), Expect = 7e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSV 196 CYLFGRAKGRQE Y NAQVFG PAPP GSV Sbjct: 22 CYLFGRAKGRQEAYANAQVFGTPAPPAGSV 51 >ref|XP_012827424.1| PREDICTED: uncharacterized protein LOC105948742 [Erythranthe guttata] gb|EYU19064.1| hypothetical protein MIMGU_mgv1a017491mg [Erythranthe guttata] Length = 71 Score = 58.9 bits (141), Expect = 9e-09 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CYLFGRAKGR+E+Y NAQVF APAPPPG+ Sbjct: 22 CYLFGRAKGRREVYANAQVFSAPAPPPGA 50 >ref|XP_022988565.1| uncharacterized protein LOC111485766 [Cucurbita maxima] Length = 71 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ+I TNAQVFG PAPPPGS Sbjct: 22 CYFLGRAKGRQDIRTNAQVFGVPAPPPGS 50 >ref|XP_022942625.1| uncharacterized protein LOC111447607 [Cucurbita moschata] Length = 71 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ+I TNAQVFG PAPPPGS Sbjct: 22 CYFIGRAKGRQDIRTNAQVFGVPAPPPGS 50 >ref|XP_022139122.1| uncharacterized protein LOC111010108 [Momordica charantia] Length = 70 Score = 54.7 bits (130), Expect = 4e-07 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ+I TNAQVFG P PPPGS Sbjct: 22 CYFIGRAKGRQDIRTNAQVFGVPTPPPGS 50 >ref|XP_008445862.1| PREDICTED: uncharacterized protein LOC103488752 [Cucumis melo] Length = 71 Score = 54.3 bits (129), Expect = 5e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ+I TNAQ+FG P PPPGS Sbjct: 22 CYFLGRAKGRQDIRTNAQIFGVPTPPPGS 50 >ref|XP_004143612.1| PREDICTED: uncharacterized protein LOC101203814 [Cucumis sativus] gb|KGN50461.1| hypothetical protein Csa_5G175840 [Cucumis sativus] Length = 71 Score = 54.3 bits (129), Expect = 5e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ+I TNAQ+FG P PPPGS Sbjct: 22 CYFLGRAKGRQDIRTNAQIFGVPTPPPGS 50 >ref|XP_012073999.1| uncharacterized protein LOC105635544 [Jatropha curcas] Length = 72 Score = 54.3 bits (129), Expect = 5e-07 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSVXNP 187 CY GRA+GRQ++ TNAQV+G P PPPG+ NP Sbjct: 22 CYFLGRARGRQDVRTNAQVYGVPTPPPGTDVNP 54 >ref|XP_015571845.1| PREDICTED: uncharacterized protein LOC107260886 [Ricinus communis] Length = 79 Score = 54.3 bits (129), Expect = 6e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSVXN 190 CY GRA+GRQ++ TNAQV+G P PPPG+V N Sbjct: 22 CYFLGRARGRQDVRTNAQVYGVPTPPPGTVTN 53 >ref|XP_019057867.1| PREDICTED: uncharacterized protein LOC109116600 [Tarenaya hassleriana] Length = 67 Score = 53.9 bits (128), Expect = 7e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSVXNP 187 CY GR++GRQ+I TN QV+GAPAPPPG+ +P Sbjct: 22 CYFLGRSRGRQDIRTNPQVYGAPAPPPGAAVSP 54 >gb|KCW77221.1| hypothetical protein EUGRSUZ_D01574 [Eucalyptus grandis] Length = 70 Score = 53.9 bits (128), Expect = 7e-07 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSVXNP 187 CY FGRA+GRQ+I TN QV+G P PPPG+ +P Sbjct: 22 CYFFGRARGRQDIRTNPQVYGTPTPPPGTFASP 54 >ref|XP_013584841.1| PREDICTED: uncharacterized protein LOC106293733 [Brassica oleracea var. oleracea] ref|XP_013720752.1| uncharacterized protein BNAC05G25270D [Brassica napus] emb|CDY49543.1| BnaC05g25270D [Brassica napus] Length = 72 Score = 53.5 bits (127), Expect = 1e-06 Identities = 20/42 (47%), Positives = 30/42 (71%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSVXNPLQARQFCQC 160 CY G+++GR+EI+TN QV+GAPAPPPG++ + + C Sbjct: 22 CYFLGKSRGRREIHTNPQVYGAPAPPPGAIISAASSPPLSPC 63 >ref|XP_021678772.1| uncharacterized protein LOC110663689 [Hevea brasiliensis] Length = 76 Score = 53.5 bits (127), Expect = 1e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ++ TNAQV+GAP PPPG+ Sbjct: 22 CYFLGRAKGRQDVRTNAQVYGAPTPPPGT 50 >gb|OAY54460.1| hypothetical protein MANES_03G076700 [Manihot esculenta] Length = 76 Score = 53.5 bits (127), Expect = 1e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ+I TNAQVFG P PPPG+ Sbjct: 22 CYFLGRAKGRQDIRTNAQVFGVPTPPPGT 50 >emb|CDP17595.1| unnamed protein product [Coffea canephora] Length = 89 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY GRAKGRQ++ NAQVFG PAPPPGS Sbjct: 22 CYFLGRAKGRQDLRNNAQVFGVPAPPPGS 50 >gb|KCW73501.1| hypothetical protein EUGRSUZ_E02008 [Eucalyptus grandis] Length = 69 Score = 52.8 bits (125), Expect = 2e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSVXNP 187 CY FGRA+GRQ+I TN QV+G P PPPG+ P Sbjct: 22 CYFFGRARGRQDIRTNPQVYGTPTPPPGTFSPP 54 >ref|XP_004491614.1| PREDICTED: uncharacterized protein LOC101489159 [Cicer arietinum] Length = 72 Score = 52.8 bits (125), Expect = 2e-06 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGS 199 CY FGRA+GR+++YTN QV+G P PPPG+ Sbjct: 22 CYFFGRARGRRDVYTNPQVYGMPTPPPGA 50 >ref|XP_003519680.1| PREDICTED: uncharacterized protein LOC100803585 [Glycine max] gb|KHN43974.1| hypothetical protein glysoja_026013 [Glycine soja] gb|KRH74048.1| hypothetical protein GLYMA_02G308300 [Glycine max] Length = 75 Score = 52.8 bits (125), Expect = 2e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 285 CYLFGRAKGRQEIYTNAQVFGAPAPPPGSV 196 CY FGRA+GR+E+ TN QV+G P+PPPG+V Sbjct: 22 CYFFGRARGRKEVQTNPQVYGMPSPPPGAV 51