BLASTX nr result
ID: Rehmannia30_contig00028334
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028334 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019163055.1| PREDICTED: replication protein A 70 kDa DNA-... 37 4e-06 >ref|XP_019163055.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit B-like [Ipomoea nil] Length = 398 Score = 37.4 bits (85), Expect(3) = 4e-06 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +1 Query: 352 KNRMTCTLWEEYIDIILPYLEGNSREPIVVI 444 K ++ CTLW+E++D + PY + +P++V+ Sbjct: 148 KKQIKCTLWDEHVDQVTPYFHSVANDPVIVL 178 Score = 35.4 bits (80), Expect(3) = 4e-06 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 171 ILTDIIGRVVSMQSAQKTQVGGKSTRFLDITLED 272 +L D+IGR+V + S + + GK +R +D LED Sbjct: 112 VLIDVIGRIVEIYSPLEKTIAGKKSRLIDFVLED 145 Score = 24.6 bits (52), Expect(3) = 4e-06 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 13 SYPRLMYVFKDFRELYDFQKIDDTML 90 ++P+ M+ FK F + Q ID+ +L Sbjct: 88 NFPKTMFCFKSFEAILSKQGIDEKVL 113