BLASTX nr result
ID: Rehmannia30_contig00027934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027934 (1208 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01243.1| hypothetical protein CDL12_26249 [Handroanthus im... 59 1e-06 gb|PIN05047.1| Mitochondrial transcription termination factor, m... 61 2e-06 gb|PIN05044.1| Mitochondrial transcription termination factor, m... 60 5e-06 gb|PIN01242.1| Mitochondrial transcription termination factor, m... 60 5e-06 >gb|PIN01243.1| hypothetical protein CDL12_26249 [Handroanthus impetiginosus] Length = 163 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 TLLKMSEEKFLKRYIVKYQKDVPELLEIYKGKLNLLE 111 TLLKM EE+FLKRY+V YQ+DVPELLEIY+ KL++ E Sbjct: 117 TLLKMPEEEFLKRYVVNYQEDVPELLEIYRRKLSVSE 153 >gb|PIN05047.1| Mitochondrial transcription termination factor, mTERF [Handroanthus impetiginosus] Length = 400 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 7 LKMSEEKFLKRYIVKYQKDVPELLEIYKGKLNLLE 111 LK+SEEKFLKRY+V YQ+DVPELL+IY+GKLN+ E Sbjct: 356 LKLSEEKFLKRYVVNYQEDVPELLDIYRGKLNVSE 390 >gb|PIN05044.1| Mitochondrial transcription termination factor, mTERF [Handroanthus impetiginosus] Length = 391 Score = 59.7 bits (143), Expect = 5e-06 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +1 Query: 1 TLLKMSEEKFLKRYIVKYQKDVPELLEIYKGKLNLLE 111 T LK+SEEKFL+RY+V YQ+DVPELL+IY+GKL++ E Sbjct: 343 TFLKLSEEKFLERYVVNYQEDVPELLDIYRGKLSVSE 379 >gb|PIN01242.1| Mitochondrial transcription termination factor, mTERF [Handroanthus impetiginosus] Length = 391 Score = 59.7 bits (143), Expect = 5e-06 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +1 Query: 1 TLLKMSEEKFLKRYIVKYQKDVPELLEIYKGKLNLLE 111 T LK+SEEKFL+RY+V YQ+DVPELL+IY+GKL++ E Sbjct: 343 TFLKLSEEKFLERYVVNYQEDVPELLDIYRGKLSVSE 379