BLASTX nr result
ID: Rehmannia30_contig00027877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027877 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086991.1| autophagy-related protein 16 [Sesamum indicum] 76 9e-13 ref|XP_012829330.1| PREDICTED: protein tipD [Erythranthe guttata... 74 6e-12 gb|PIN18301.1| WD40 repeat protein TipD [Handroanthus impetigino... 72 2e-11 gb|EPS62240.1| hypothetical protein M569_12551, partial [Genlise... 69 2e-10 ref|XP_022882793.1| autophagy-related protein 16 [Olea europaea ... 67 1e-09 ref|XP_019245398.1| PREDICTED: autophagy-related protein 16 [Nic... 67 1e-09 ref|XP_016446741.1| PREDICTED: autophagy-related protein 16-like... 67 1e-09 ref|XP_009594594.1| PREDICTED: autophagy-related protein 16 [Nic... 67 1e-09 gb|OIT03090.1| autophagy-related protein 16 [Nicotiana attenuata] 67 2e-09 gb|PHU16525.1| hypothetical protein BC332_17730, partial [Capsic... 66 2e-09 gb|PHT86166.1| hypothetical protein T459_08272, partial [Capsicu... 66 2e-09 gb|PHT53766.1| hypothetical protein CQW23_08228, partial [Capsic... 66 2e-09 ref|XP_016563743.1| PREDICTED: autophagy-related protein 16 [Cap... 66 2e-09 gb|POE48558.1| autophagy-related protein 16 [Quercus suber] 62 5e-09 ref|XP_019180792.1| PREDICTED: autophagy-related protein 16 [Ipo... 65 5e-09 ref|XP_016496549.1| PREDICTED: autophagy-related protein 16-like... 65 5e-09 ref|XP_009779845.1| PREDICTED: protein tipD [Nicotiana sylvestris] 65 5e-09 ref|XP_024025596.1| autophagy-related protein 16 [Morus notabilis] 64 9e-09 gb|EXB94441.1| Protein tipD [Morus notabilis] 64 9e-09 emb|CDP15089.1| unnamed protein product [Coffea canephora] 64 9e-09 >ref|XP_011086991.1| autophagy-related protein 16 [Sesamum indicum] Length = 509 Score = 75.9 bits (185), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS Sbjct: 478 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 509 >ref|XP_012829330.1| PREDICTED: protein tipD [Erythranthe guttata] gb|EYU17771.1| hypothetical protein MIMGU_mgv1a004798mg [Erythranthe guttata] Length = 509 Score = 73.6 bits (179), Expect = 6e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 5 EHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 EHTSPVLCCSWSNLGKPLATSDKNGNIC+WS Sbjct: 479 EHTSPVLCCSWSNLGKPLATSDKNGNICIWS 509 >gb|PIN18301.1| WD40 repeat protein TipD [Handroanthus impetiginosus] Length = 509 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCCSWSNLGKPLA+SDK+GNIC+WS Sbjct: 478 KEHTSPVLCCSWSNLGKPLASSDKSGNICIWS 509 >gb|EPS62240.1| hypothetical protein M569_12551, partial [Genlisea aurea] Length = 508 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEH SPVLCCSWSNLGKP+A+SDKNGNIC+W+ Sbjct: 477 KEHGSPVLCCSWSNLGKPVASSDKNGNICIWT 508 >ref|XP_022882793.1| autophagy-related protein 16 [Olea europaea var. sylvestris] Length = 514 Score = 67.0 bits (162), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVL CSWS LGKPLATSDKNGNIC+W+ Sbjct: 478 KEHTAPVLSCSWSGLGKPLATSDKNGNICIWN 509 >ref|XP_019245398.1| PREDICTED: autophagy-related protein 16 [Nicotiana attenuata] Length = 509 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS LGKPLATSDK+G IC+WS Sbjct: 478 KEHTAPVLCCSWSGLGKPLATSDKSGIICIWS 509 >ref|XP_016446741.1| PREDICTED: autophagy-related protein 16-like [Nicotiana tabacum] Length = 509 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS LGKPLATSDK+G IC+WS Sbjct: 478 KEHTAPVLCCSWSGLGKPLATSDKSGIICIWS 509 >ref|XP_009594594.1| PREDICTED: autophagy-related protein 16 [Nicotiana tomentosiformis] Length = 509 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS LGKPLATSDK+G IC+WS Sbjct: 478 KEHTAPVLCCSWSGLGKPLATSDKSGIICIWS 509 >gb|OIT03090.1| autophagy-related protein 16 [Nicotiana attenuata] Length = 1206 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS LGKPLATSDK+G IC+WS Sbjct: 1175 KEHTAPVLCCSWSGLGKPLATSDKSGIICIWS 1206 >gb|PHU16525.1| hypothetical protein BC332_17730, partial [Capsicum chinense] Length = 508 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCC+WS LGKPLATSDK+G +C+WS Sbjct: 477 KEHTSPVLCCTWSGLGKPLATSDKSGIVCIWS 508 >gb|PHT86166.1| hypothetical protein T459_08272, partial [Capsicum annuum] Length = 508 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCC+WS LGKPLATSDK+G +C+WS Sbjct: 477 KEHTSPVLCCTWSGLGKPLATSDKSGIVCIWS 508 >gb|PHT53766.1| hypothetical protein CQW23_08228, partial [Capsicum baccatum] Length = 508 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCC+WS LGKPLATSDK+G +C+WS Sbjct: 477 KEHTSPVLCCTWSGLGKPLATSDKSGIVCIWS 508 >ref|XP_016563743.1| PREDICTED: autophagy-related protein 16 [Capsicum annuum] Length = 509 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCC+WS LGKPLATSDK+G +C+WS Sbjct: 478 KEHTSPVLCCTWSGLGKPLATSDKSGIVCIWS 509 >gb|POE48558.1| autophagy-related protein 16 [Quercus suber] Length = 149 Score = 62.4 bits (150), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 +EHTSPVLCCSWS LGKPLA++D+NG IC W+ Sbjct: 118 REHTSPVLCCSWSGLGKPLASADRNGIICTWT 149 >ref|XP_019180792.1| PREDICTED: autophagy-related protein 16 [Ipomoea nil] Length = 507 Score = 65.1 bits (157), Expect = 5e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS LGKPLAT+DK+G +C+WS Sbjct: 476 KEHTAPVLCCSWSGLGKPLATADKSGIVCIWS 507 >ref|XP_016496549.1| PREDICTED: autophagy-related protein 16-like [Nicotiana tabacum] Length = 509 Score = 65.1 bits (157), Expect = 5e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS GKPLATSDK+G IC+WS Sbjct: 478 KEHTAPVLCCSWSGFGKPLATSDKSGIICIWS 509 >ref|XP_009779845.1| PREDICTED: protein tipD [Nicotiana sylvestris] Length = 509 Score = 65.1 bits (157), Expect = 5e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+PVLCCSWS GKPLATSDK+G IC+WS Sbjct: 478 KEHTAPVLCCSWSGFGKPLATSDKSGIICIWS 509 >ref|XP_024025596.1| autophagy-related protein 16 [Morus notabilis] Length = 509 Score = 64.3 bits (155), Expect = 9e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCCSWS LGKPLA++DKNG +C W+ Sbjct: 478 KEHTSPVLCCSWSGLGKPLASADKNGVVCTWT 509 >gb|EXB94441.1| Protein tipD [Morus notabilis] Length = 525 Score = 64.3 bits (155), Expect = 9e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHTSPVLCCSWS LGKPLA++DKNG +C W+ Sbjct: 494 KEHTSPVLCCSWSGLGKPLASADKNGVVCTWT 525 >emb|CDP15089.1| unnamed protein product [Coffea canephora] Length = 592 Score = 64.3 bits (155), Expect = 9e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 KEHTSPVLCCSWSNLGKPLATSDKNGNICVWS 97 KEHT+ VLCCSWS GKPLATSDKNG+IC+W+ Sbjct: 561 KEHTTSVLCCSWSGFGKPLATSDKNGSICIWT 592