BLASTX nr result
ID: Rehmannia30_contig00027581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027581 (724 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix d... 98 7e-23 ref|WP_078101538.1| photosystem II reaction center protein PsbM ... 90 6e-20 ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cres... 71 3e-19 gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium r... 87 4e-19 dbj|GAY33504.1| hypothetical protein CUMW_286780 [Citrus unshiu] 82 4e-17 gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum... 75 2e-14 ref|WP_082924831.1| photosystem II reaction center protein PsbM,... 70 1e-12 gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophi... 71 1e-12 gb|AVM81381.1| photosystem II protein M (chloroplast) [Adenocaly... 70 2e-12 gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sat... 70 3e-12 ref|YP_009366249.1| PSII M protein (plastid) [Aloysia citrodora]... 67 1e-11 ref|YP_009354399.1| photosystem II protein M (chloroplast) [Cycl... 67 1e-11 ref|YP_009186162.1| photosystem II protein M (chloroplast) [Jugl... 67 1e-11 gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaen... 68 1e-11 ref|YP_009040786.1| photosystem II protein M (chloroplast) (chlo... 67 2e-11 ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]... 67 3e-11 ref|YP_009407099.1| photosystem II protein M (chloroplast) [Plat... 67 3e-11 gb|ATV97192.1| photosystem II protein M (chloroplast) [Allantoma... 67 3e-11 ref|YP_009375686.1| PsbM (chloroplast) [Diplostephium phylicoide... 66 4e-11 gb|AKZ30297.1| photosystem II protein M (chloroplast) [Goodenia ... 66 4e-11 >gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix dactylifera] Length = 70 Score = 97.8 bits (242), Expect = 7e-23 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -2 Query: 345 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 166 +E T +F+IS GL+PELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN Sbjct: 11 VELTGVKFLISMGLDPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 70 >ref|WP_078101538.1| photosystem II reaction center protein PsbM [Staphylococcus aureus] gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium raimondii] Length = 50 Score = 89.7 bits (221), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 309 GLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 GLNPELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D Sbjct: 2 GLNPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50 >ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cressa cretica] gb|ASJ65073.1| photosystem II protein M (chloroplast) [Cressa cretica] Length = 79 Score = 71.2 bits (173), Expect(3) = 3e-19 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -2 Query: 282 KKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 K+ DEIMEVNILAFIATALFILVPTAF LIIYVKTVSQ+D Sbjct: 40 KRRDEIMEVNILAFIATALFILVPTAFFLIIYVKTVSQSD 79 Score = 41.2 bits (95), Expect(3) = 3e-19 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -1 Query: 349 IH*IYRRKIYHL*GIKSRVIAK*KNR*D 266 IH I++RKIYHL GIKSRVIAK K R D Sbjct: 16 IHCIFKRKIYHLYGIKSRVIAKLKKRRD 43 Score = 31.6 bits (70), Expect(3) = 3e-19 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 398 IVIHDIDPIQDHREVIHSL 342 + IHDIDPI+ HR+VIH + Sbjct: 1 MAIHDIDPIRYHRDVIHCI 19 >gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium raimondii] Length = 50 Score = 87.4 bits (215), Expect = 4e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -2 Query: 309 GLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 GLNPELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKT+ Q+D Sbjct: 2 GLNPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50 >dbj|GAY33504.1| hypothetical protein CUMW_286780 [Citrus unshiu] Length = 53 Score = 82.4 bits (202), Expect = 4e-17 Identities = 44/52 (84%), Positives = 46/52 (88%), Gaps = 3/52 (5%) Frame = -2 Query: 309 GLNPELLRSKK---TDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 GLNPELLRSKK DE MEVNILAFIAT LF+LVPTAFLLIIYVKTVSQ+D Sbjct: 2 GLNPELLRSKKKKPNDETMEVNILAFIATTLFVLVPTAFLLIIYVKTVSQSD 53 >gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum auriculatum] Length = 50 Score = 75.1 bits (183), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 289 AK*KNR*DYGSKYSCIYCYCTIHSSSYRFSTYHLRKNSQSK 167 +K K R DYGSKYSCI CYCTIHSSSYR STYHLRKN+QSK Sbjct: 10 SKKKKRLDYGSKYSCICCYCTIHSSSYRLSTYHLRKNNQSK 50 >ref|WP_082924831.1| photosystem II reaction center protein PsbM, partial [Paenarthrobacter nicotinovorans] Length = 39 Score = 70.1 bits (170), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 279 KTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 K +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D Sbjct: 1 KKNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 39 >gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophila parviflora] Length = 69 Score = 70.9 bits (172), Expect = 1e-12 Identities = 41/61 (67%), Positives = 43/61 (70%) Frame = -2 Query: 345 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 166 +EFT F P K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN Sbjct: 12 LEFTGYPFYSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68 Query: 165 D 163 D Sbjct: 69 D 69 >gb|AVM81381.1| photosystem II protein M (chloroplast) [Adenocalymma acutissimum] gb|AVM81468.1| photosystem II protein M (chloroplast) [Adenocalymma divaricatum] Length = 37 Score = 69.7 bits (169), Expect = 2e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*FN 154 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND FN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSFN 37 >gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica Group] gb|AAS46173.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica Group] gb|ADD62823.1| photosystem II protein M (chloroplast) [Oryza sativa Japonica Group] gb|ADD62891.1| photosystem II protein M (chloroplast) [Oryza meridionalis] gb|ADD62959.1| photosystem II protein M (chloroplast) [Oryza australiensis] gb|AGY48933.1| photosystem II reaction center protein M (chloroplast) [Oryza rufipogon] Length = 69 Score = 70.1 bits (170), Expect = 3e-12 Identities = 41/61 (67%), Positives = 43/61 (70%) Frame = -2 Query: 345 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 166 +EFT F P K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN Sbjct: 12 LEFTGYPFPSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68 Query: 165 D 163 D Sbjct: 69 D 69 >ref|YP_009366249.1| PSII M protein (plastid) [Aloysia citrodora] gb|ARJ61921.1| PSII M protein (plastid) [Aloysia citrodora] Length = 37 Score = 67.4 bits (163), Expect = 1e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 157 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSF 36 >ref|YP_009354399.1| photosystem II protein M (chloroplast) [Cyclocarya paliurus] gb|ARA90741.1| photosystem II protein M (chloroplast) [Cyclocarya paliurus] Length = 37 Score = 67.4 bits (163), Expect = 1e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 157 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSF 36 >ref|YP_009186162.1| photosystem II protein M (chloroplast) [Juglans regia] ref|YP_009306650.1| photosystem II protein M (chloroplast) [Juglans sigillata] ref|YP_009347442.1| photosystem II protein M (chloroplast) [Juglans mandshurica] ref|YP_009347528.1| photosystem II protein M (chloroplast) [Juglans cathayensis] ref|YP_009347614.1| photosystem II protein M (chloroplast) [Juglans hopeiensis] ref|YP_009430708.1| photosystem II protein M (chloroplast) [Juglans cinerea] ref|YP_009430792.1| photosystem II protein M (chloroplast) [Juglans hindsii] ref|YP_009430875.1| photosystem II protein M (chloroplast) [Juglans major] ref|YP_009430958.1| photosystem II protein M (chloroplast) [Juglans nigra] gb|ALO71557.1| photosystem II protein M (chloroplast) [Juglans regia] gb|ANG44774.1| photosystem II protein M (chloroplast) [Juglans regia] gb|AOQ30849.1| photosystem II protein M (chloroplast) [Juglans sigillata] gb|APW28890.1| photosystem II protein M (chloroplast) [Juglans mandshurica] gb|APW28976.1| photosystem II protein M (chloroplast) [Juglans cathayensis] gb|APW29062.1| photosystem II protein M (chloroplast) [Juglans hopeiensis] gb|AQT38477.1| photosystem II protein M (chloroplast) [Annamocarya sinensis] gb|ASM81858.1| photosystem II protein M (chloroplast) [Juglans cathayensis] gb|ASM81940.1| photosystem II protein M (chloroplast) [Juglans cinerea] gb|ASM82025.1| photosystem II protein M (chloroplast) [Juglans hindsii] gb|ASM82107.1| photosystem II protein M (chloroplast) [Juglans major] gb|ASM82191.1| photosystem II protein M (chloroplast) [Juglans mandshurica] gb|ASM82274.1| photosystem II protein M (chloroplast) [Juglans nigra] gb|ASM82357.1| photosystem II protein M (chloroplast) [Juglans regia] gb|ASM82441.1| photosystem II protein M (chloroplast) [Juglans regia] gb|ASM82523.1| photosystem II protein M (chloroplast) [Juglans sigillata] Length = 37 Score = 67.4 bits (163), Expect = 1e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 157 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSF 36 >gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaena stipoides] Length = 69 Score = 68.2 bits (165), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 270 EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 E+MEVNILAFIATALFILVPTAFLLIIYVKT SQND Sbjct: 34 EVMEVNILAFIATALFILVPTAFLLIIYVKTASQND 69 >ref|YP_009040786.1| photosystem II protein M (chloroplast) (chloroplast) [Centaurea diffusa] ref|YP_009235797.1| photosystem II reaction center protein (chloroplast) [Saussurea involucrata] ref|YP_009341771.1| photosystem II protein M (chloroplast) [Castanopsis concinna] ref|YP_009460497.1| photosystem II reaction center protein M (plastid) [Cirsium arvense] ref|YP_009460585.1| photosystem II protein M (plastid) [Cirsium eriophorum] ref|YP_009460673.1| photosystem II protein M (plastid) [Cirsium vulgare] gb|AIB03740.1| photosystem II protein M (chloroplast) (chloroplast) [Centaurea diffusa] gb|AKF00090.1| photosystem II protein M (chloroplast) [Orania palindan] gb|AKF00165.1| photosystem II protein M (chloroplast) [Pelagodoxa henryana] gb|AKF00239.1| photosystem II protein M (chloroplast) [Podococcus barteri] gb|AKF00299.1| photosystem II protein M (chloroplast) [Prestoea acuminata var. montana] gb|AKF00356.1| photosystem II protein M (chloroplast) [Reinhardtia gracilis] gb|AKF00431.1| photosystem II protein M (chloroplast) [Reinhardtia latisecta] gb|AKF00495.1| photosystem II protein M (chloroplast) [Roystonea regia] gb|AKF00635.1| photosystem II protein M (chloroplast) [Reinhardtia simplex] gb|AKF00696.1| photosystem II protein M (chloroplast) [Satakentia liukiuensis] gb|AKF00768.1| photosystem II protein M (chloroplast) [Sclerosperma profizianum] gb|AKF00992.1| photosystem II protein M (chloroplast) [Attalea speciosa] gb|AKF01068.1| photosystem II protein M (chloroplast) [Bactris major] gb|AKF01144.1| photosystem II protein M (chloroplast) [Beccariophoenix madagascariensis] gb|AKF01226.1| photosystem II protein M (chloroplast) [Burretiokentia grandiflora] gb|AKF01290.1| photosystem II protein M (chloroplast) [Dictyosperma album] gb|AKF01368.1| photosystem II protein M (chloroplast) [Drymophloeus litigiosus] gb|AKF01440.1| photosystem II protein M (chloroplast) [Dypsis decaryi] gb|AKF01525.1| photosystem II protein M (chloroplast) [Geonoma undata subsp. dussiana] gb|AKF01600.1| photosystem II protein M (chloroplast) [Heterospathe cagayanensis] gb|AKF01681.1| photosystem II protein M (chloroplast) [Hydriastele microspadix] gb|AKF01846.1| photosystem II protein M (chloroplast) [Kentiopsis piersoniorum] gb|AKF01910.1| photosystem II protein M (chloroplast) [Leopoldinia pulchra] gb|AKF02070.1| photosystem II protein M (chloroplast) [Oenocarpus bataua] gb|AKF02131.1| photosystem II protein M (chloroplast) [Oenocarpus minor] gb|ALN96566.1| photosystem II protein M (chloroplast) [Castanopsis concinna] gb|AMD61937.1| photosystem II reaction center protein (chloroplast) [Saussurea involucrata] gb|AUT81862.1| photosystem II reaction center protein M (plastid) [Cirsium arvense] gb|AUT81950.1| photosystem II protein M (plastid) [Cirsium eriophorum] gb|AUT82038.1| photosystem II protein M (plastid) [Cirsium vulgare] Length = 35 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 267 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 +MEVNILAFIATALFILVPTAFLLIIYVKTVSQND Sbjct: 1 MMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 35 >ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana] ref|NP_054490.1| photosystem II protein M [Nicotiana tabacum] ref|NP_039371.1| photosystem II protein M (plastid) [Oryza sativa Japonica Group] ref|NP_054926.1| photosystem II protein M (plastid) [Spinacia oleracea] ref|NP_783226.1| photosystem II protein M [Atropa belladonna] ref|YP_052737.1| photosystem II protein M (chloroplast) [Oryza nivara] ref|YP_053149.1| photosystem II protein M [Nymphaea alba] ref|YP_319759.1| photosystem II protein M [Acorus calamus] ref|YP_358667.1| photosystem II protein M [Nicotiana sylvestris] ref|YP_358572.1| photosystem II protein M [Phalaenopsis aphrodite subsp. formosana] ref|YP_398854.1| photosystem II protein M [Nicotiana tomentosiformis] ref|YP_538842.1| photosystem II protein M [Solanum bulbocastanum] ref|YP_588103.1| photosystem II protein M (chloroplast) [Helianthus annuus] ref|YP_635633.1| photosystem II protein M [Solanum tuberosum] ref|YP_740196.1| photosystem II protein M [Liriodendron tulipifera] ref|YP_740559.1| photosystem II protein M [Platanus occidentalis] ref|YP_778484.1| photosystem II protein M [Jasminum nudiflorum] ref|YP_784380.1| photosystem II protein M [Drimys granadensis] ref|YP_001001528.1| photosystem II protein M [Nuphar advena] ref|YP_001004180.1| photosystem II protein M [Ranunculus macranthus] ref|YP_001123367.1| photosystem II protein M [Capsella bursa-pastoris] ref|YP_001123280.1| PSII low MW protein [Barbarea verna] ref|YP_001123631.1| photosystem II protein M [Lepidium virginicum] ref|YP_001123808.1| photosystem II protein M [Nasturtium officinale] ref|YP_001123109.1| photosystem II protein M [Olimarabidopsis pumila] ref|YP_001123456.1| photosystem II protein M [Crucihimalaya wallichii] ref|YP_001294092.1| photosystem II protein M [Chloranthus spicatus] ref|YP_001294346.1| photosystem II protein M [Dioscorea elephantipes] ref|YP_001294264.1| photosystem II protein M [Illicium oligandrum] ref|YP_001294178.1| photosystem II protein M [Buxus microphylla] ref|YP_001468302.1| photosystem II protein M [Ipomoea purpurea] ref|YP_001586176.1| photosystem II protein M [Acorus americanus] ref|YP_001595502.1| PSII M protein [Lemna minor] ref|YP_001837346.1| photosystem II protein M [Guizotia abyssinica] ref|YP_001936511.1| photosystem II protein M [Fagopyrum esculentum subsp. ancestrale] ref|YP_002836084.1| photosystem II protein M [Megaleranthis saniculifolia] ref|YP_003029728.1| PsbM (chloroplast) [Bambusa oldhamii] ref|YP_003097564.1| photosystem II protein M (chloroplast) [Dendrocalamus latiflorus] ref|YP_003359353.1| photosystem II protein M (chloroplast) [Olea europaea] ref|YP_003433969.1| photosystem II protein M [Typha latifolia] ref|YP_003540925.1| photosystem II protein M [Phoenix dactylifera] ref|YP_003587656.1| photosystem II protein M [Anomochloa marantoidea] ref|YP_004021144.1| photosystem II protein M [Castanea mollissima] ref|YP_004376415.1| photosystem II protein M [Olea europaea subsp. europaea] ref|YP_004563861.1| photosystem II protein M [Nelumbo lutea] ref|YP_004563775.1| photosystem II protein M [Olea europaea subsp. cuspidata] ref|YP_004563998.1| photosystem II protein M [Olea woodiana subsp. woodiana] ref|YP_004564358.1| photosystem II protein M (chloroplast) [Ageratina adenophora] ref|YP_004564491.1| photosystem II protein M [Olea europaea subsp. maroccana] ref|YP_004733233.1| photosystem II protein M (plastid) [Indocalamus longiauritus] ref|YP_004733567.1| photosystem II protein M (chloroplast) [Phyllostachys edulis] ref|YP_004733749.1| photosystem II protein M (chloroplast) [Acidosasa purpurea] ref|YP_004733967.1| photosystem II protein M (chloroplast) [Phyllostachys nigra var. henonis] ref|YP_004734090.1| photosystem II protein M (chloroplast) [Bambusa emeiensis] ref|YP_004734174.1| photosystem II protein M (plastid) [Ferrocalamus rimosivaginus] ref|YP_004769624.1| photosystem II protein M (chloroplast) [Spirodela polyrhiza] ref|YP_004769708.1| photosystem II protein M [Magnolia kwangsiensis] ref|YP_004769806.1| photosystem II protein M (chloroplast) [Wolffiella lingulata] ref|YP_004769941.1| photosystem II protein M (chloroplast) [Wolffia australiana] ref|YP_004891595.1| psbM gene product (chloroplast) [Nicotiana undulata] ref|YP_004935660.1| PSII M protein (chloroplast) [Sesamum indicum] ref|YP_004940504.1| psbM gene product (chloroplast) [Dorcoceras hygrometricum] ref|YP_005087998.1| psbM gene product [Leersia tisserantii] ref|YP_005088521.1| psbM gene product (chloroplast) [Phyllostachys propinqua] ref|YP_005089135.1| psbM gene product [Rhynchoryza subulata] ref|YP_005089328.1| psbM gene product (chloroplast) [Silene vulgaris] ref|YP_005089409.1| psbM gene product (chloroplast) [Silene noctiflora] ref|YP_005089490.1| psbM gene product (chloroplast) [Silene conica] ref|YP_005089571.1| psbM gene product (chloroplast) [Silene latifolia] ref|YP_005097868.1| photosystem II protein M (chloroplast) [Colocasia esculenta] ref|YP_005296407.1| psbM gene product (chloroplast) [Oryza meridionalis] ref|YP_006073098.1| photosystem II protein M (chloroplast) [Elaeis guineensis] ref|YP_006073262.1| photosystem II protein M (chloroplast) [Phalaenopsis equestris] ref|YP_006280748.1| psbM gene product (chloroplast) [Oryza rufipogon] ref|YP_006503785.1| photosystem II M protein (chloroplast) [Datura stramonium] ref|YP_006576109.1| PsbM (chloroplast) [Magnolia denudata] ref|YP_006665774.1| photosystem II protein M (chloroplast) [Elodea canadensis] ref|YP_006666024.1| photosystem II protein M (chloroplast) [Capsicum annuum] ref|YP_007317242.1| PSII M protein (chloroplast) [Camellia sinensis] ref|YP_007353909.1| photosystem II protein M (chloroplast) [Tectona grandis] ref|YP_007375037.1| photosystem II protein M [Quercus rubra] ref|YP_007474364.1| photosystem II M protein (chloroplast) [Magnolia officinalis] ref|YP_007474446.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp. biloba] ref|YP_007474530.1| photosystem II M protein (chloroplast) [Magnolia grandiflora] ref|YP_007475128.1| photosystem II protein M (chloroplast) [Arundinaria gigantea] ref|YP_007475613.1| photosystem II protein M [Heliconia collinsiana] ref|YP_007475698.1| photosystem II protein M [Zingiber spectabile] ref|YP_007475783.1| photosystem II protein M [Pseudophoenix vinifera] ref|YP_007475955.1| photosystem II protein M [Bismarckia nobilis] ref|YP_007476041.1| photosystem II protein M (plastid) [Dasypogon bromeliifolius] ref|YP_007475869.1| photosystem II protein M [Calamus caryotoides] ref|YP_007476345.1| PsbM (chloroplast) [Trithuria inconspicua] ref|YP_007507105.1| photosystem II M protein (chloroplast) [Salvia miltiorrhiza] ref|YP_007889936.1| photosystem II protein M (chloroplast) [Pachycladon cheesemanii] ref|YP_008081259.1| photosystem II protein M (chloroplast) (chloroplast) [Catharanthus roseus] ref|YP_008081359.1| photosystem II protein M (chloroplast) [Tetracentron sinense] ref|YP_008081451.1| photosystem II protein M (chloroplast) [Trochodendron aralioides] ref|YP_008082575.1| photosystem II protein M (chloroplast) [Utricularia gibba] ref|YP_008378780.1| photosystem II protein M (chloroplast) [Najas flexilis] ref|YP_008520133.1| photosystem II protein M (chloroplast) [Camellia taliensis] ref|YP_008563082.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] ref|YP_008578279.1| photosystem II protein M (chloroplast) [Cocos nucifera] ref|YP_008592751.1| photosystem II protein M (chloroplast) [Camellia cuspidata] ref|YP_008592840.1| photosystem II protein M (chloroplast) [Camellia danzaiensis] ref|YP_008592927.1| photosystem II protein M (chloroplast) [Camellia impressinervis] ref|YP_008593105.1| photosystem II protein M (chloroplast) [Camellia yunnanensis] ref|YP_008592482.1| PSII M protein (chloroplast) [Andrographis paniculata] ref|YP_008593016.1| photosystem II protein M (chloroplast) [Camellia pitardii] ref|YP_008815931.1| photosystem II protein M (chloroplast) [Lindenbergia philippensis] ref|YP_008854419.1| photosystem II protein M [Musa textilis] ref|YP_008854505.1| photosystem II protein M [Ravenala madagascariensis] ref|YP_008854588.1| photosystem II protein M [Curcuma roscoeana] ref|YP_008963300.1| photosystem II protein M [Camellia oleifera] ref|YP_008963474.1| photosystem II protein M (chloroplast) [Penthorum chinense] ref|YP_008964343.1| photosystem II protein M [Helianthus divaricatus] ref|YP_008964428.1| photosystem II protein M [Helianthus decapetalus] ref|YP_008964683.1| photosystem II protein M [Helianthus strumosus] ref|YP_008964768.1| photosystem II protein M [Helianthus maximiliani] ref|YP_008964028.1| photosystem II protein M [Ajuga reptans] ref|YP_008964173.1| photosystem II protein M [Helianthus giganteus] ref|YP_008964258.1| photosystem II protein M [Helianthus grosseserratus] ref|YP_008964513.1| photosystem II protein M [Helianthus hirsutus] ref|YP_008964598.1| photosystem II protein M [Helianthus tuberosus] ref|YP_008993963.1| photosystem II protein M (chloroplast) [Pharus lappulaceus] ref|YP_008993170.1| photosystem II protein M (chloroplast) [Magnolia cathcartii] ref|YP_008993256.1| photosystem II protein M (chloroplast) [Magnolia macrophylla var. dealbata] ref|YP_008993342.1| photosystem II protein M (chloroplast) [Magnolia pyramidata] ref|YP_008993428.1| photosystem II protein M (chloroplast) [Magnolia kobus] ref|YP_008993514.1| photosystem II protein M (chloroplast) [Magnolia liliifera] ref|YP_008993600.1| photosystem II protein M (chloroplast) [Magnolia odora] ref|YP_008993772.1| photosystem II protein M (chloroplast) [Magnolia sinica] ref|YP_008993858.1| photosystem II protein M (chloroplast) [Magnolia sprengeri] ref|YP_008993686.1| photosystem II protein M (chloroplast) [Magnolia salicifolia] ref|YP_008964861.1| photosystem II protein M (chloroplast) [Schwalbea americana] ref|YP_009000009.1| photosystem II protein M (chloroplast) [Silene conoidea] ref|YP_009000170.1| photosystem II protein M (chloroplast) [Silene paradoxa] ref|YP_009000090.1| photosystem II protein M (chloroplast) [Silene chalcedonica] ref|YP_009001981.1| photosystem II protein M (chloroplast) [Puelia olyriformis] ref|YP_009002252.1| photosystem II protein M (chloroplast) [Pinguicula ehlersiae] ref|YP_009020214.1| photosystem II protein M (chloroplast) [Castanopsis echinocarpa] ref|YP_009020729.1| photosystem II protein M (chloroplast) [Praxelis clematidea] ref|YP_009024243.1| photosystem II protein M (chloroplast) [Arundinaria appalachiana] ref|YP_009024326.1| photosystem II protein M (chloroplast) [Arundinaria tecta] ref|YP_009024787.1| photosystem II protein M (chloroplast) [Trigonobalanus doichangensis] ref|YP_009026875.1| photosystem II protein M (plastid) [Magnolia tripetala] ref|YP_009033432.1| photosystem II protein M (plastid) [Olyra latifolia] ref|YP_009034085.1| photosystem II protein M (plastid) [Oryza glaberrima] ref|YP_009033879.1| photosystem II protein M (plastid) [Dioscorea rotundata] ref|YP_009040312.1| photosystem II protein M [Hyoscyamus niger] ref|YP_009041081.1| photosystem II protein M [Rhazya stricta] ref|YP_009047926.1| photosystem II protein M (chloroplast) [Camellia crapnelliana] ref|YP_009048015.1| photosystem II protein M (chloroplast) [Nymphaea mexicana] ref|YP_009048281.1| photosystem II protein M (chloroplast) [Magnolia yunnanensis] ref|YP_009049257.1| photosystem II protein M (chloroplast) [Oryza australiensis] ref|YP_009050582.1| photosystem II protein M (chloroplast) [Camellia grandibracteata] ref|YP_009050669.1| photosystem II protein M (chloroplast) [Camellia leptophylla] ref|YP_009050756.1| photosystem II protein M (chloroplast) [Camellia petelotii] ref|YP_009050843.1| photosystem II protein M (chloroplast) [Camellia pubicosta] ref|YP_009050930.1| photosystem II protein M (chloroplast) [Camellia reticulata] ref|YP_009051239.1| photosystem II protein M (chloroplast) [Bambusa multiplex] ref|YP_009051324.1| photosystem II protein M (chloroplast) [Phyllostachys sulphurea] ref|YP_009052573.1| photosystem II protein M (chloroplast) [Arundinaria fargesii] ref|YP_009052656.1| photosystem II protein M (chloroplast) [Sarocalamus faberi] ref|YP_009052740.1| photosystem II protein M (chloroplast) [Chimonocalamus longiusculus] ref|YP_009052822.1| photosystem II protein M (chloroplast) [Fargesia nitida] ref|YP_009052905.1| photosystem II protein M (chloroplast) [Fargesia spathacea] ref|YP_009052988.1| photosystem II protein M (chloroplast) [Fargesia yunnanensis] ref|YP_009053071.1| photosystem II protein M (chloroplast) [Gaoligongshania megalothyrsa] ref|YP_009053154.1| photosystem II protein M (chloroplast) [Gelidocalamus tessellatus] ref|YP_009053237.1| photosystem II protein M (chloroplast) [Indocalamus wilsonii] ref|YP_009053320.1| photosystem II protein M (chloroplast) [Indosasa sinica] ref|YP_009053402.1| photosystem II protein M (chloroplast) [Oligostachyum shiuyingianum] ref|YP_009053649.1| photosystem II protein M (chloroplast) [Yushania levigata] ref|YP_009053484.1| photosystem II protein M (chloroplast) [Pleioblastus maculatus] ref|YP_009053566.1| photosystem II protein M (chloroplast) [Thamnocalamus spathiflorus] ref|YP_009053868.1| photosystem II protein M (plastid) [Ampelocalamus calcareus] ref|YP_009093944.1| photosystem II protein M (chloroplast) [Nelumbo nucifera] ref|YP_009092761.1| photosystem II protein M [Bomarea edulis] ref|YP_009093794.1| photosystem II protein M (chloroplast) [Luzuriaga radicans] ref|YP_009108435.1| photosystem II protein M (chloroplast) [Genlisea margaretae] ref|YP_009107557.1| photosystem II protein M (chloroplast) [Phalaenopsis hybrid cultivar] ref|YP_009108492.1| photosystem II protein M (chloroplast) [Utricularia macrorhiza] ref|YP_009110596.1| photosystem II protein M (chloroplast) [Hesperelaea palmeri] ref|YP_009108668.1| photosystem II protein M [Nerium oleander] ref|YP_009114863.1| photosystem II protein M [Thalictrum coreanum] ref|YP_009116336.1| photosystem II protein M (chloroplast) [Ananas comosus] ref|YP_009117215.1| photosystem II protein M (chloroplast) [Premna microphylla] ref|YP_009117669.1| photosystem II protein M (plastid) [Acorus gramineus] ref|YP_009128065.1| photosystem II protein M (chloroplast) [Actinidia deliciosa] ref|YP_009128175.1| photosystem II protein M (chloroplast) [Saracha punctata] ref|YP_009128385.1| photosystem II protein M (chloroplast) [Ipomoea batatas] ref|YP_009128834.1| photosystem II protein M (chloroplast) [Iochroma loxense] ref|YP_009123246.1| photosystem II protein M (chloroplast) [Chloranthus japonicus] ref|YP_009123627.1| photosystem II protein M (chloroplast) [Iochroma stenanthum] ref|YP_009123736.1| photosystem II protein M [Lithocarpus balansae] ref|YP_009127982.1| photosystem II protein M (chloroplast) [Actinidia chinensis] ref|YP_009123151.1| photosystem II protein M (chloroplast) [Dunalia obovata] ref|YP_009123345.1| photosystem II protein M (chloroplast) [Iochroma nitidum] ref|YP_009129354.1| photosystem II protein M (chloroplast) [Cypripedium formosanum] ref|YP_009130121.1| photosystem II protein M (chloroplast) [Carludovica palmata] ref|YP_009130316.1| photosystem II protein M (chloroplast) [Quercus aliena] ref|YP_009131707.1| photosystem II protein M (chloroplast) [Solanum cheesmaniae] ref|YP_009131956.1| photosystem II protein M (chloroplast) [Solanum habrochaites] ref|YP_009132039.1| photosystem II protein M (chloroplast) [Solanum neorickii] ref|YP_009132830.1| photosystem II protein M (chloroplast) [Quercus spinosa] ref|YP_009133049.1| photosystem II protein M (chloroplast) [Quercus aquifolioides] ref|YP_009131790.1| photosystem II protein M (chloroplast) [Solanum chilense] ref|YP_009131873.1| photosystem II protein M (chloroplast) [Solanum galapagense] ref|YP_009132122.1| photosystem II protein M (chloroplast) [Solanum peruvianum] ref|YP_009132205.1| photosystem II protein M (chloroplast) [Solanum pimpinellifolium] ref|YP_009132746.1| photosystem II protein M (chloroplast) [Dunalia brachyacantha] ref|YP_009120911.1| photosystem II protein M (plastid) [Sabal domingensis] ref|YP_009120997.1| photosystem II protein M (plastid) [Cardamine impatiens] ref|YP_009121082.1| photosystem II protein M (plastid) [Cardamine resedifolia] ref|YP_009122858.1| photosystem II protein M (chloroplast) [Capsicum lycianthoides] ref|YP_009123519.1| photosystem II protein M (plastid) [Physalis peruviana] ref|YP_009134769.1| photosystem II protein M (plastid) [Bambusa bambos] ref|YP_009134852.1| photosystem II protein M (plastid) [Bambusa arnhemica] ref|YP_009134935.1| photosystem II protein M (plastid) [Chusquea spectabilis] ref|YP_009135018.1| photosystem II protein M (plastid) [Diandrolyra sp. Clark 1301] ref|YP_009135098.1| photosystem II protein M (plastid) [Greslania sp. McPherson 19217] ref|YP_009135181.1| photosystem II protein M (plastid) [Hickelia madagascariensis] ref|YP_009135264.1| photosystem II protein M (plastid) [Neohouzeaua sp. Clark & Attigala 1712] ref|YP_009135347.1| photosystem II protein M (plastid) [Neololeba atra] ref|YP_009135430.1| photosystem II protein M (plastid) [Olmeca reflexa] ref|YP_009135513.1| photosystem II protein M (plastid) [Raddia brasiliensis] ref|YP_009135681.1| photosystem II protein M (plastid) [Buergersiochloa bambusoides] ref|YP_009135764.1| photosystem II protein M (plastid) [Chusquea liebmannii] ref|YP_009135846.1| photosystem II protein M (plastid) [Lithachne pauciflora] ref|YP_009135926.1| photosystem II protein M (plastid) [Otatea acuminata] ref|YP_009136009.1| photosystem II protein M (plastid) [Pariana radiciflora] ref|YP_009136726.1| photosystem II protein M (plastid) [Guadua weberbaueri] ref|YP_009139095.1| photosystem II protein M (chloroplast) [Dioscorea zingiberensis] ref|YP_009139462.1| photosystem II protein M (chloroplast) [Dunalia solanacea] ref|YP_009139774.1| photosystem II protein M (chloroplast) [Cynara humilis] ref|YP_009141857.1| photosystem II protein M (chloroplast) [Xerophyllum tenax] ref|YP_009141944.1| photosystem II protein M (chloroplast) [Heloniopsis tubiflora] ref|YP_009142044.1| PsbM (chloroplast) [Fagopyrum tataricum] ref|YP_009142320.1| photosystem II protein M (chloroplast) [Iochroma tingoanum] ref|YP_009142477.1| photosystem II protein M (chloroplast) [Chikusichloa aquatica] ref|YP_009145098.1| photosystem II protein M (chloroplast) [Podococcus barteri] ref|YP_009143883.1| photosystem II protein M (plastid) [Cypripedium japonicum] ref|YP_009144316.1| photosystem II protein M (plastid) [Carex siderosticta] ref|YP_009144509.1| PSII M protein (chloroplast) [Salvia rosmarinus] ref|YP_009144973.1| photosystem II protein M (chloroplast) [Dieffenbachia seguine] ref|YP_009155529.1| photosystem II protein M (chloroplast) [Oryza barthii] ref|YP_009155611.1| photosystem II protein M (chloroplast) [Oryza glumipatula] ref|YP_009155694.1| photosystem II protein M (chloroplast) [Oryza longistaminata] ref|YP_009155777.1| photosystem II protein M (chloroplast) [Oryza officinalis] ref|YP_009156194.1| photosystem II protein M (plastid) [Avena sativa] ref|YP_009156362.1| photosystem II protein M (plastid) [Brachyelytrum aristosum] ref|YP_009156697.1| photosystem II protein M (plastid) [Diarrhena obovata] ref|YP_009156946.1| photosystem II protein M (plastid) [Melica mutica] ref|YP_009157029.1| photosystem II protein M (plastid) [Melica subulata] ref|YP_009157196.1| photosystem II protein M (plastid) [Phaenosperma globosum] ref|YP_009157280.1| photosystem II protein M (plastid) [Phalaris arundinacea] ref|YP_009157891.1| photosystem II protein M (plastid) [Chusquea circinata] ref|YP_009157975.1| photosystem II protein M (plastid) [Pariana campestris] ref|YP_009154772.1| photosystem II protein M (chloroplast) [Aster spathulifolius] ref|YP_009159820.1| photosystem II protein M (chloroplast) [Carnegiea gigantea] ref|YP_009162255.1| photosystem II M protein (chloroplast) [Scutellaria baicalensis] ref|YP_009161178.1| PsbM (chloroplast) [Oryza punctata] ref|YP_009161548.1| photosystem II protein M (chloroplast) [Pinellia ternata] ref|YP_009161915.1| photosystem II protein M (chloroplast) [Capsella rubella] ref|YP_009162871.1| photosystem II protein M (chloroplast) [Rheum palmatum] ref|YP_009164575.1| photosystem II protein M (chloroplast) [Lathraea squamaria] ref|YP_009166599.1| photosystem II protein M (chloroplast) [Epipremnum aureum] ref|YP_009166685.1| photosystem II protein M (chloroplast) [Tanaecium tetragonolobum] ref|YP_009169350.1| photosystem II protein M (chloroplast) [Clematis terniflora] ref|YP_009169480.1| photosystem II protein M (chloroplast) [Cynara baetica] ref|YP_009169567.1| photosystem II protein M (chloroplast) [Cynara cornigera] ref|YP_009169662.1| PsbM (chloroplast) [Capsicum frutescens] ref|YP_009170171.1| photosystem II protein M (plastid) [Colpothrinax cookii] ref|YP_009171776.1| PsbM (chloroplast) [Solanum commersonii] ref|YP_009171862.1| PsbM (chloroplast) [Solanum nigrum] ref|YP_009172271.1| photosystem II protein M (chloroplast) [Colobanthus quitensis] ref|YP_009175267.1| photosystem II protein M (chloroplast) [Phragmipedium longifolium] ref|YP_009178652.1| photosystem II protein M (chloroplast) [Pseudosasa japonica] ref|YP_009179050.1| photosystem II protein M (chloroplast) [Ostrya rehderiana] ref|YP_009179946.1| photosystem II protein M (chloroplast) [Bletilla striata] ref|YP_009180365.1| photosystem II protein M (chloroplast) [Musa balbisiana] ref|YP_009182885.1| photosystem II protein M (chloroplast) [Capsella grandiflora] ref|YP_009182983.1| photosystem II protein M (plastid) [Plantago maritima] ref|YP_009183073.1| photosystem II protein M (plastid) [Plantago media] ref|YP_009183586.1| photosystem II protein M (chloroplast) [Scutellaria insignis] ref|YP_009184048.1| photosystem II protein M (chloroplast) [Dendrobium chrysotoxum] ref|YP_009186480.1| photosystem II protein M (plastid) [Otatea glauca] ref|YP_009192956.1| photosystem II protein M (chloroplast) [Curcuma flaviflora] ref|YP_009228758.1| photosystem II protein M (chloroplast) [Metanarthecium luteoviride] ref|YP_009229201.1| photosystem II protein M (chloroplast) [Guadua chacoensis] ref|YP_009229375.1| photosystem II protein M (chloroplast) [Syagrus coronata] ref|YP_009231069.1| photosystem II protein M (chloroplast) [Camelina sativa] ref|YP_009234380.1| photosystem II protein M (chloroplast) [Akebia trifoliata] ref|YP_009234549.1| photosystem II protein M (chloroplast) [Euptelea pleiosperma] ref|YP_009234634.1| photosystem II protein M (chloroplast) [Meliosma aff. cuneifolia Moore 333] ref|YP_009234803.1| photosystem II protein M (chloroplast) [Stephania japonica] ref|YP_009234888.1| photosystem II protein M (chloroplast) [Pachysandra terminalis] ref|YP_009236490.1| photosystem II protein M (chloroplast) [Quercus baronii] ref|YP_009239071.1| photosystem II protein M (chloroplast) [Monsonia emarginata] ref|YP_009240593.1| photosystem II protein M (chloroplast) [Iochroma cardenasianum] ref|YP_009240697.1| photosystem II protein M (chloroplast) [Guadua angustifolia] ref|YP_009240788.1| PSII M protein (chloroplast) [Diplopanax stachyanthus] ref|YP_009241301.1| psbM (chloroplast) [Drosera rotundifolia] ref|YP_009241740.1| photosystem II protein M (plastid) [Tofieldia thibetica] ref|YP_009241825.1| photosystem II protein M (plastid) [Potamogeton perfoliatus] ref|YP_009241910.1| photosystem II protein M (plastid) [Sagittaria lichuanensis] ref|YP_009242057.1| photosystem II protein M (chloroplast) [Stenogyne haliakalae] ref|YP_009242145.1| photosystem II protein M (chloroplast) [Stenogyne bifida] ref|YP_009242233.1| photosystem II protein M (chloroplast) [Haplostachys haplostachya] ref|YP_009242321.1| photosystem II protein M (chloroplast) [Phyllostegia velutina] ref|YP_009242409.1| photosystem II protein M (chloroplast) [Stenogyne kanehoana] ref|YP_009242497.1| photosystem II protein M (chloroplast) [Stachys chamissonis] ref|YP_009242585.1| photosystem II protein M (chloroplast) [Stachys coccinea] ref|YP_009242673.1| photosystem II protein M (chloroplast) [Stachys sylvatica] ref|YP_009242761.1| photosystem II protein M (chloroplast) [Stachys byzantina] ref|YP_009243024.1| photosystem II M protein (chloroplast) [Aconitum chiisanense] ref|YP_009243210.1| photosystem II protein M (chloroplast) [Iochroma australe] ref|YP_009245004.1| photosystem II M protein (chloroplast) [Kolkwitzia amabilis] ref|YP_009247060.1| photosystem II protein M (chloroplast) [Mauritia flexuosa] ref|YP_009247146.1| photosystem II protein M (plastid) [Caryota mitis] ref|YP_009247232.1| photosystem II protein M (plastid) [Wallichia densiflora] ref|YP_009247317.1| photosystem II protein M (plastid) [Veitchia arecina] ref|YP_009247403.1| photosystem II protein M (plastid) [Trithrinax brasiliensis] ref|YP_009247489.1| photosystem II protein M (plastid) [Tahina spectabilis] ref|YP_009247569.1| photosystem II protein M (plastid) [Serenoa repens] ref|YP_009247741.1| photosystem II protein M (plastid) [Pritchardia thurstonii] ref|YP_009247827.1| photosystem II protein M (plastid) [Pigafetta elata] ref|YP_009247914.1| photosystem II protein M (plastid) [Phytelephas aequatorialis] ref|YP_009248000.1| photosystem II protein M (plastid) [Nypa fruticans] ref|YP_009248086.1| photosystem II protein M (plastid) [Metroxylon warburgii] ref|YP_009248172.1| photosystem II protein M (plastid) [Lodoicea maldivica] ref|YP_009248258.1| photosystem II protein M (plastid) [Leucothrinax morrisii] ref|YP_009248344.1| photosystem II protein M (plastid) [Hanguana malayana] ref|YP_009248430.1| photosystem II protein M (plastid) [Eugeissona tristis] ref|YP_009248512.1| photosystem II protein M (plastid) [Eremospatha macrocarpa] ref|YP_009248598.1| photosystem II protein M (plastid) [Corypha lecomtei] ref|YP_009248684.1| photosystem II protein M (plastid) [Chuniophoenix nana] ref|YP_009248770.1| photosystem II protein M (plastid) [Chamaerops humilis] ref|YP_009248856.1| photosystem II protein M (plastid) [Brahea brandegeei] ref|YP_009248942.1| photosystem II protein M (plastid) [Borassodendron machadonis] ref|YP_009249028.1| photosystem II protein M (plastid) [Baxteria australis] ref|YP_009249114.1| photosystem II protein M (plastid) [Arenga caudata] ref|YP_009249200.1| photosystem II protein M (plastid) [Areca vestiaria] ref|YP_009249279.1| photosystem II protein M (plastid) [Acoelorraphe wrightii] ref|YP_009249365.1| photosystem II protein M (plastid) [Washingtonia robusta] ref|YP_009250859.1| photosystem II protein M (chloroplast) [Iochroma umbellatum] ref|YP_009250976.1| photosystem II protein M (plastid) [Geranium incanum] ref|YP_009251230.1| photosystem II protein M (chloroplast) [Acnistus arborescens x Iochroma cyaneum] ref|YP_009251638.1| photosystem II protein M (chloroplast) [Colchicum autumnale] ref|YP_009251724.1| photosystem II protein M (chloroplast) [Gloriosa superba] ref|YP_009252484.1| photosystem II protein M (plastid) [Annona cherimola] ref|YP_009252586.1| photosystem II protein M (chloroplast) [Iochroma lehmannii] ref|YP_009252669.1| photosystem II protein M (chloroplast) [Iochroma salpoanum] ref|YP_009252842.1| photosystem II protein M (chloroplast) [Eriolarynx fasciculata] ref|YP_009252935.1| photosystem II protein M (chloroplast) [Helianthus debilis] ref|YP_009253067.1| photosystem II protein M (chloroplast) [Iochroma ellipticum] ref|YP_009253151.1| photosystem II protein M (chloroplast) [Iochroma cyaneum] ref|YP_009253244.1| photosystem II protein M (chloroplast) [Bruinsmia polysperma] ref|YP_009253382.1| photosystem II protein M (chloroplast) [Acnistus arborescens] ref|YP_009254072.1| PsbM (plastid) [Solanum melongena] ref|YP_009254209.1| photosystem II protein M (chloroplast) [Erythranthe lutea] ref|YP_009255600.1| PSII M protein (chloroplast) [Cornus controversa] ref|YP_009255861.1| photosystem II protein M (chloroplast) [Helianthus argophyllus] ref|YP_009256028.1| photosystem II protein M (chloroplast) [Scopolia parviflora] ref|YP_009256227.1| photosystem II protein M (chloroplast) [Oryza minuta] ref|YP_009258162.1| PSII low MW protein (chloroplast) [Arabidopsis suecica] ref|YP_009261474.1| photosystem II protein M (chloroplast) [Liriodendron chinense] ref|YP_009266410.1| photosystem II protein M (chloroplast) [Oryza brachyantha] ref|YP_009262857.1| PsbM (chloroplast) [Capsicum chinense] ref|YP_009269555.1| photosystem II protein M (chloroplast) [Cephalanthera longifolia] ref|YP_009270039.1| photosystem II protein M (chloroplast) [Listera fugongensis] ref|YP_009269641.1| photosystem II protein M (chloroplast) [Epipactis mairei] ref|YP_009269838.1| photosystem II protein M (chloroplast) [Epipactis veratrifolia] ref|YP_009269954.1| photosystem II protein M (chloroplast) [Neottia pinetorum] ref|YP_009270125.1| photosystem II protein M (chloroplast) [Neottia ovata] ref|YP_009270906.1| PsbM (chloroplast) [Perilla setoyensis] ref|YP_009271290.1| photosystem II protein M (chloroplast) [Amaranthus hypochondriacus] ref|YP_009272242.1| photosystem II protein M (chloroplast) [Diospyros oleifera] ref|YP_009272342.1| photosystem II protein M (chloroplast) [Diospyros kaki] ref|YP_009270730.1| PsbM (chloroplast) [Perilla citriodora] ref|YP_009270818.1| PsbM (chloroplast) [Perilla frutescens] ref|YP_009271032.1| photosystem II M protein (chloroplast) [Aconitum carmichaelii] ref|YP_009271176.1| photosystem II protein M (chloroplast) [Ampelocalamus naibunensis] ref|YP_009271455.1| PsbM (chloroplast) [Eclipta prostrata] ref|YP_009271892.1| PsbM (chloroplast) [Carthamus tinctorius] ref|YP_009271984.1| photosystem II protein M (chloroplast) [Diospyros glaucifolia] ref|YP_009272155.1| photosystem II protein M (chloroplast) [Diospyros lotus] ref|YP_009272489.1| photosystem II protein M (chloroplast) [Utricularia reniformis] ref|YP_009294857.1| photosystem II protein M (plastid) [Veronica nakaiana] ref|YP_009298354.1| photosystem II protein M (chloroplast) [Actinidia polygama] ref|YP_009298437.1| photosystem II protein M (chloroplast) [Actinidia tetramera] ref|YP_009305292.1| PsbM (chloroplast) [Oryza sativa] ref|YP_009295098.1| photosystem II protein M (chloroplast) [Ipomoea nil] ref|YP_009305543.1| photosystem II protein M (plastid) [Veronica persica] ref|YP_009305629.1| photosystem II protein M (plastid) [Veronicastrum sibiricum] ref|YP_009305909.1| photosystem II protein M (chloroplast) [Quercus variabilis] ref|YP_009305995.1| photosystem II protein M (chloroplast) [Quercus dolicholepis] ref|YP_009306464.1| photosystem II protein M (chloroplast) [Helwingia himalaica] ref|YP_009306771.1| photosystem II protein M (chloroplast) [Davidia involucrata] ref|YP_009308072.1| photosystem II M protein (chloroplast) [Aconitum austrokoreense] ref|YP_009308469.1| photosystem II proteinM (chloroplast) [Aconitum ciliare] ref|YP_009308555.1| photosystem II proteinM (chloroplast) [Aconitum coreanum] ref|YP_009308640.1| photosystem II proteinM (chloroplast) [Aconitum kusnezoffii] ref|YP_009308725.1| photosystem II proteinM (chloroplast) [Aconitum monanthum] ref|YP_009308997.1| photosystem II protein M (chloroplast) [Joinvillea ascendens] ref|YP_009309271.1| PSII M protein (chloroplast) [Pogostemon yatabeanus] ref|YP_009309358.1| PSII M protein (chloroplast) [Pogostemon stellatus] ref|YP_009309445.1| PSII M protein (chloroplast) [Paulownia coreana] ref|YP_009309532.1| PSII M protein (chloroplast) [Paulownia tomentosa] ref|YP_009309868.1| PSII M protein (chloroplast) [Abeliophyllum distichum] ref|YP_009309955.1| PSII low MW protein M (chloroplast) [Coreanomecon hylomeconoides] ref|YP_009310512.1| photosystem II protein M (chloroplast) [Cabomba caroliniana] ref|YP_009312609.1| PsbM (chloroplast) [Avena sterilis] ref|YP_009312697.1| photosystem II protein M (chloroplast) [Ranunculus occidentalis] ref|YP_009317903.1| photosystem II protein M (chloroplast) [Haberlea rhodopensis] ref|YP_009316307.1| photosystem II protein M (plastid) [Castilleja paramensis] ref|YP_009316972.1| photosystem II protein M (chloroplast) [Nymphaea jamesoniana] ref|YP_009317286.1| photosystem II protein M (chloroplast) [Mikania micrantha] ref|YP_009317793.1| photosystem II protein M (chloroplast) [Trollius chinensis] ref|YP_009318533.1| photosystem II protein M (chloroplast) [Dracocephalum palmatum] ref|YP_009319989.1| photosystem II protein M (plastid) [Alniphyllum eberhardtii] ref|YP_009317982.1| photosystem II protein M (chloroplast) [Galinsoga quadriradiata] ref|YP_009327381.1| photosystem II M protein (chloroplast) [Mentha longifolia] ref|YP_009334399.1| photosystem II protein M (chloroplast) [Albuca kirkii] ref|YP_009336371.1| photosystem II protein M (chloroplast) [Nicotiana otophora] ref|YP_009338155.1| photosystem II M protein (chloroplast) [Gymnaconitum gymnandrum] ref|YP_009338624.1| PSII low MW protein M (chloroplast) [Averrhoa carambola] ref|YP_009338746.1| PSII low MW protein M (chloroplast) [Carissa macrocarpa] ref|YP_009341867.1| photosystem II protein M (chloroplast) [Aletris spicata] ref|YP_009341952.1| photosystem II protein M (chloroplast) [Aletris fauriei] ref|YP_009344244.1| PsbM (chloroplast) [Capsicum eximium] ref|YP_009342756.1| PSII low MW protein M (chloroplast) [Pouteria campechiana] ref|YP_009342841.1| PSII low MW protein M (chloroplast) [Diospyros blancoi] ref|YP_009343983.1| PsbM (chloroplast) [Capsicum galapagoense] ref|YP_009344070.1| PsbM (chloroplast) [Capsicum chacoense] ref|YP_009344157.1| PsbM (chloroplast) [Capsicum tovarii] ref|YP_009344430.1| PSII M protein (chloroplast) [Rehmannia chingii] ref|YP_009342926.1| photosystem II protein M (chloroplast) [Carpinus putoensis] ref|YP_009349516.1| photosystem II protein M (chloroplast) [Betula nana] ref|YP_009346251.1| photosystem II protein M (chloroplast) [Leptaspis banksii] ref|YP_009346326.1| photosystem II protein M (chloroplast) [Leptaspis zeylanica] ref|YP_009347230.1| photosystem II protein M (chloroplast) [Castanea henryi] ref|YP_009348457.1| photosystem II protein M (chloroplast) [Akebia quinata] ref|YP_009349268.1| photosystem II protein M (chloroplast) [Symplocarpus renifolius] ref|YP_009346168.1| photosystem II protein M (chloroplast) [Streptochaeta spicata] ref|YP_009354872.1| photosystem II protein M (plastid) [Echinacea angustifolia] ref|YP_009353622.1| photosystem II protein M (chloroplast) [Ostrya trichocarpa] ref|YP_009353936.1| PSII M protein (chloroplast) [Rehmannia glutinosa] ref|YP_009354024.1| PSII M protein (chloroplast) [Rehmannia henryi] ref|YP_009354111.1| PSII M protein (chloroplast) [Rehmannia solanifolia] ref|YP_009354199.1| PSII M protein (chloroplast) [Rehmannia piasezkii] ref|YP_009354286.1| PSII M protein (chloroplast) [Rehmannia elata] ref|YP_009354617.1| photosystem II protein M (plastid) [Echinacea pallida] ref|YP_009354702.1| photosystem II protein M (plastid) [Echinacea laevigata] ref|YP_009354787.1| photosystem II protein M (plastid) [Echinacea atrorubens] ref|YP_009354957.1| photosystem II protein M (plastid) [Echinacea speciosa] ref|YP_009355042.1| photosystem II protein M (plastid) [Echinacea tennesseensis] ref|YP_009355127.1| photosystem II protein M (plastid) [Echinacea purpurea] ref|YP_009355212.1| photosystem II protein M (plastid) [Echinacea sanguinea] ref|YP_009356434.1| PSII low MW protein (chloroplast) [Lepidium meyenii] ref|YP_009356521.1| photosystem II protein M (chloroplast) [Tarenaya hassleriana] ref|YP_009354532.1| photosystem II protein M (plastid) [Echinacea paradoxa] ref|YP_009364387.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] ref|YP_009364664.1| photosystem II protein M (plastid) [Ipomoea trifida] ref|YP_009369202.1| photosystem II protein M (chloroplast) [Oryza latifolia] ref|YP_009369289.1| photosystem II protein M (chloroplast) [Oryza longiglumis] ref|YP_009369376.1| photosystem II protein M (chloroplast) [Oryza ridleyi] ref|YP_009369549.1| photosystem II protein M (chloroplast) [Leersia japonica] ref|YP_009368854.1| photosystem II protein M (chloroplast) [Oryza rhizomatis] ref|YP_009368941.1| photosystem II protein M (chloroplast) [Oryza eichingeri] ref|YP_009369463.1| photosystem II protein M (chloroplast) [Oryza meyeriana] ref|YP_009365570.1| PsbM (plastid) [Magnolia biondii] ref|YP_009366165.1| photosystem II protein M (plastid) [Jasminum sambac] ref|YP_009366079.1| photosystem II M protein (plastid) [Scutellaria lateriflora] ref|YP_009366916.1| photosystem II protein M (plastid) [Illicium anisatum] ref|YP_009365442.1| photosystem II protein M (plastid) [Illicium floridanum] ref|YP_009365485.1| photosystem II protein M (plastid) [Dioscorea villosa] ref|YP_009365654.1| photosystem II protein M (plastid) [Digitalis lanata] ref|YP_009365737.1| photosystem II protein M (plastid) [Illicium verum] ref|YP_009365911.1| photosystem II protein M (plastid) [Jasminum tortuosum] ref|YP_009366590.1| photosystem II protein M (plastid) [Illicium henryi] ref|YP_009366834.1| photosystem II protein M (plastid) [Hydrastis canadensis] ref|YP_009372216.1| PsbM (chloroplast) [Diplostephium huertasii] ref|YP_009372471.1| PsbM (chloroplast) [Diplostephium obtusum] ref|YP_009371876.1| PsbM (chloroplast) [Diplostephium violaceum] ref|YP_009371961.1| PsbM (chloroplast) [Diplostephium oblongifolium] ref|YP_009371791.1| PsbM (chloroplast) [Diplostephium rhododendroides] ref|YP_009372046.1| PsbM (chloroplast) [Llerasia caucana] ref|YP_009372131.1| PsbM (chloroplast) [Diplostephium juajibioyi] ref|YP_009372386.1| PsbM (chloroplast) [Diplostephium meyenii] ref|YP_009372556.1| PsbM (chloroplast) [Diplostephium tachirense] ref|YP_009372641.1| PsbM (chloroplast) [Diplostephium serratifolium] ref|YP_009372726.1| PsbM (chloroplast) [Diplostephium mutiscuanum] ref|YP_009372896.1| PsbM (chloroplast) [Diplostephium jenesanum] ref|YP_009373477.1| PsbM (chloroplast) [Diplostephium alveolatum] ref|YP_009373562.1| PsbM (chloroplast) [Archibaccharis asperifolia] ref|YP_009373647.1| PsbM (chloroplast) [Oritrophium peruvianum] ref|YP_009374156.1| PsbM (chloroplast) [Heterothalamus alienus] ref|YP_009374411.1| PsbM (chloroplast) [Laestadia muscicola] ref|YP_009374496.1| PsbM (chloroplast) [Diplostephium rhomboidale] ref|YP_009376621.1| PsbM (chloroplast) [Hinterhubera ericoides] ref|YP_009377131.1| PsbM (chloroplast) [Parastrephia quadrangularis] ref|YP_009377471.1| PsbM (chloroplast) [Diplostephium jaramilloi] ref|YP_009377641.1| PsbM (chloroplast) [Diplostephium heterophyllum] ref|YP_009377726.1| PsbM (chloroplast) [Diplostephium camargoanum] ref|YP_009378236.1| PsbM (chloroplast) [Diplostephium ochraceum] ref|YP_009380292.1| PsbM (chloroplast) [Solanum berthaultii] ref|YP_009373902.1| PsbM (chloroplast) [Baccharis genistelloides] ref|YP_009374581.1| PsbM (chloroplast) [Diplostephium tenuifolium] ref|YP_009374666.1| PsbM (chloroplast) [Diplostephium colombianum] ref|YP_009374836.1| PsbM (chloroplast) [Diplostephium revolutum] ref|YP_009374921.1| PsbM (chloroplast) [Exostigma notobellidiastrum] ref|YP_009375006.1| PsbM (chloroplast) [Diplostephium rupestre] ref|YP_009375091.1| PsbM (chloroplast) [Blakiella bartsiifolia] ref|YP_009375261.1| PsbM (chloroplast) [Baccharis tricuneata] ref|YP_009375346.1| PsbM (chloroplast) [Diplostephium cinereum] ref|YP_009375771.1| PsbM (chloroplast) [Diplostephium eriophorum] ref|YP_009375856.1| PsbM (chloroplast) [Diplostephium glutinosum] ref|YP_009375941.1| PsbM (chloroplast) [Diplostephium antioquense] ref|YP_009376026.1| PsbM (chloroplast) [Laennecia sophiifolia] ref|YP_009376196.1| PsbM (chloroplast) [Diplostephium costaricense] ref|YP_009376366.1| PsbM (chloroplast) [Diplostephium crypteriophyllum] ref|YP_009376706.1| PsbM (chloroplast) [Diplostephium romeroi] ref|YP_009376876.1| PsbM (chloroplast) [Diplostephium venezuelense] ref|YP_009377046.1| PsbM (chloroplast) [Westoniella kohkemperi] ref|YP_009377301.1| PsbM (chloroplast) [Diplostephium schultzii] ref|YP_009377386.1| PsbM (chloroplast) [Diplostephium frontinense] ref|YP_009377556.1| PsbM (chloroplast) [Diplostephium inesianum] ref|YP_009377811.1| PsbM (chloroplast) [Aztecaster matudae] ref|YP_009377896.1| PsbM (chloroplast) [Diplostephium coriaceum] ref|YP_009377981.1| PsbM (chloroplast) [Diplostephium rosmarinifolium] ref|YP_009378151.1| PsbM (chloroplast) [Diplostephium apiculatum] ref|YP_009378408.1| photosystem II protein M (chloroplast) [Schisandra chinensis] ref|YP_009378670.1| photosystem II protein M (chloroplast) [Actinidia arguta] ref|YP_009378754.1| photosystem II protein M (chloroplast) [Actinidia eriantha] ref|YP_009378838.1| photosystem II protein M (chloroplast) [Actinidia kolomikta] ref|YP_009380124.1| PsbM (chloroplast) [Chenopodium quinoa] ref|YP_009380208.1| PsbM (chloroplast) [Chenopodium album] ref|YP_009383722.1| photosystem II protein M (chloroplast) [Chionanthus retusus] ref|YP_009383522.1| photosystem II protein M (chloroplast) [Aster altaicus] ref|YP_009383871.1| photosystem II protein M (chloroplast) [Morella rubra] ref|YP_009388654.1| photosystem II protein M (chloroplast) [Cistanthe longiscapa] ref|YP_009388764.1| photosystem II protein M (chloroplast) [Ocimum basilicum] ref|YP_009389670.1| photosystem II protein M (chloroplast) [Lychnis wilfordii] ref|YP_009389753.1| photosystem II protein M (chloroplast) [Silene capitata] ref|YP_009390212.1| photosystem II M protein (chloroplast) [Salvia japonica] ref|YP_009401387.1| photosystem II protein M (chloroplast) [Dendrobium salaccense] ref|YP_009407324.1| photosystem II protein M (chloroplast) [Aldrovanda vesiculosa] ref|YP_009407392.1| photosystem II protein M (chloroplast) [Dionaea muscipula] ref|YP_009407474.1| photosystem II protein M (chloroplast) [Sinojackia xylocarpa] ref|YP_009411893.1| photosystem II protein M (plastid) [Schima multibracteata] ref|YP_009413422.1| photosystem II protein M (chloroplast) [Camellia azalea] ref|YP_009408866.1| photosystem II protein M (chloroplast) [Zantedeschia aethiopica] ref|YP_009411545.1| photosystem II protein M (plastid) [Schima argentea] ref|YP_009411632.1| photosystem II protein M (plastid) [Schima brevipedicellata] ref|YP_009411719.1| photosystem II protein M (plastid) [Schima crenata] ref|YP_009411806.1| photosystem II protein M (plastid) [Schima khasiana] ref|YP_009411980.1| photosystem II protein M (plastid) [Schima noronhae] ref|YP_009412067.1| photosystem II protein M (plastid) [Schima remotiserrata] ref|YP_009412154.1| photosystem II protein M (plastid) [Schima sericans] ref|YP_009412241.1| photosystem II protein M (plastid) [Schima sinensis] ref|YP_009412328.1| photosystem II protein M (plastid) [Schima superba] ref|YP_009412415.1| photosystem II protein M (plastid) [Schima wallichii] ref|YP_009414981.1| photosystem II protein M (chloroplast) [Victoria cruziana] ref|YP_009415066.1| photosystem II protein M (chloroplast) [Barclaya longifolia] ref|YP_009415212.1| photosystem II protein M (chloroplast) [Musella lasiocarpa] ref|YP_009415312.1| photosystem II protein M (plastid) [Pyrenaria menglaensis] ref|YP_009415399.1| photosystem II protein M (plastid) [Stewartia sinensis] ref|YP_009415486.1| photosystem II protein M (plastid) [Apterosperma oblata] ref|YP_009415573.1| photosystem II protein M (plastid) [Pyrenaria pingpienensis] ref|YP_009415660.1| photosystem II protein M (plastid) [Polyspora speciosa] ref|YP_009415747.1| photosystem II protein M (plastid) [Pyrenaria khasiana] ref|YP_009415834.1| photosystem II protein M (plastid) [Polyspora axillaris] ref|YP_009415921.1| photosystem II protein M (plastid) [Gordonia brandegeei] ref|YP_009416008.1| photosystem II protein M (plastid) [Stewartia crassifolia] ref|YP_009416095.1| photosystem II protein M (plastid) [Polyspora dalgleishiana] ref|YP_009416182.1| photosystem II protein M (plastid) [Stewartia cordifolia] ref|YP_009416269.1| photosystem II protein M (plastid) [Stewartia rubiginosa] ref|YP_009416356.1| photosystem II protein M (plastid) [Camellia szechuanensis] ref|YP_009416443.1| photosystem II protein M (plastid) [Camellia elongata] ref|YP_009416530.1| photosystem II protein M (plastid) [Adinandra angustifolia] ref|YP_009416617.1| photosystem II protein M (plastid) [Diospyros strigosa] ref|YP_009416730.1| photosystem II protein M (chloroplast) [Magnolia insignis] ref|YP_009418092.1| photosystem II protein M (plastid) [Stewartia malacodendron] ref|YP_009418788.1| photosystem II protein M (plastid) [Gordonia lasianthus] ref|YP_009419310.1| photosystem II protein M (plastid) [Barringtonia racemosa] ref|YP_009419919.1| photosystem II protein M (plastid) [Melliodendron xylocarpum] ref|YP_009417337.1| photosystem II protein M (plastid) [Adinandra millettii] ref|YP_009417437.1| photosystem II protein M (chloroplast) [Nymphaea ampla] ref|YP_009417657.1| photosystem II protein M (plastid) [Pyrenaria microcarpa] ref|YP_009417744.1| photosystem II protein M (plastid) [Tutcheria championii] ref|YP_009417831.1| photosystem II protein M (plastid) [Camellia mairei] ref|YP_009417918.1| photosystem II protein M (plastid) [Polyspora longicarpa] ref|YP_009418005.1| photosystem II protein M (plastid) [Stewartia pteropetiolata] ref|YP_009418179.1| photosystem II protein M (plastid) [Franklinia alatamaha] ref|YP_009418266.1| photosystem II protein M (plastid) [Polyspora hainanensis] ref|YP_009418353.1| photosystem II protein M (plastid) [Pyrenaria oblongicarpa] ref|YP_009418440.1| photosystem II protein M (plastid) [Stewartia ovata] ref|YP_009418527.1| photosystem II protein M (plastid) [Stewartia calcicola] ref|YP_009418614.1| photosystem II protein M (plastid) [Stewartia pseudocamellia] ref|YP_009418701.1| photosystem II protein M (plastid) [Stewartia rostrata] ref|YP_009418875.1| photosystem II protein M (plastid) [Gordonia fruticosa] ref|YP_009418962.1| photosystem II protein M (plastid) [Barringtonia fusicarpa] ref|YP_009419049.1| photosystem II protein M (plastid) [Symplocos paniculata] ref|YP_009419136.1| photosystem II protein M (plastid) [Diospyros dumetorum] ref|YP_009419223.1| photosystem II protein M (plastid) [Pyrenaria diospyricarpa] ref|YP_009419397.1| photosystem II protein M (plastid) [Ternstroemia gymnanthera] ref|YP_009419484.1| photosystem II protein M (plastid) [Sladenia celastrifolia] ref|YP_009419571.1| photosystem II protein M (plastid) [Symplocos costaricana] ref|YP_009419658.1| photosystem II protein M (plastid) [Anneslea fragrans] ref|YP_009419832.1| photosystem II protein M (plastid) [Sinojackia rehderiana] ref|YP_009420567.1| photosystem II protein M (chloroplast) [Musa itinerans] ref|YP_009420655.1| photosystem II protein M (chloroplast) [Solanum dulcamara] ref|YP_009420888.1| photosystem II protein M (chloroplast) [Caryopteris mongholica] ref|YP_009421351.1| photosystem II protein M (chloroplast) [Solanum pennellii] ref|YP_009428455.1| photosystem II protein M (chloroplast) [Conyza bonariensis] ref|YP_009424557.1| PSII low MW protein M (chloroplast) [Pelatantheria scolopendrifolia] ref|YP_009424631.1| PSII low MW protein M (chloroplast) [Gastrochilus fuscopunctatus] ref|YP_009424705.1| PSII low MW protein M (chloroplast) [Thrixspermum japonicum] ref|YP_009424852.1| PSII low MW protein M (chloroplast) [Gastrochilus japonicus] ref|YP_009427977.1| photosystem II protein M (chloroplast) [Ambrosia artemisiifolia] ref|YP_009428072.1| PSII M protein (chloroplast) [Echinacanthus lofouensis] ref|YP_009428701.1| PsbM (chloroplast) [Aconitum pseudolaeve] ref|YP_009428614.1| PsbM (chloroplast) [Aconitum longecassidatum] ref|YP_009428972.1| photosystem II protein M (chloroplast) [Alpinia oxyphylla] ref|YP_009428789.1| photosystem II protein M (chloroplast) [Decaisnea insignis] ref|YP_009429347.1| photosystem II protein M (plastid) [Rheum wittrockii] ref|YP_009429444.1| photosystem II protein M (chloroplast) [Nicotiana attenuata] ref|YP_009429795.1| photosystem II protein M (chloroplast) [Magnolia laevifolia] ref|YP_009433185.1| photosystem II protein M (chloroplast) [Pedicularis cheilanthifolia] ref|YP_009433798.1| PSII M protein (chloroplast) [Hypolytrum nemorum] ref|YP_009433879.1| PSII M protein (chloroplast) [Carex neurocarpa] ref|YP_009434242.1| photosystem II protein M (chloroplast) [Camptotheca acuminata] ref|YP_009434673.1| photosystem II protein M (chloroplast) [Sinowilsonia henryi] ref|YP_009437462.1| photosystem II protein M (chloroplast) [Primulina eburnea] ref|YP_009437550.1| photosystem II protein M (chloroplast) [Primulina liboensis] ref|YP_009440667.1| photosystem II protein M (chloroplast) [Aristolochia contorta] ref|YP_009440752.1| photosystem II protein M (chloroplast) [Aristolochia debilis] ref|YP_009440837.1| photosystem II protein M (plastid) [Japonolirion osense] ref|YP_009441434.1| photosystem II protein M (chloroplast) [Portulaca oleracea] ref|YP_009443139.1| photosystem II protein M (chloroplast) [Pleione bulbocodioides] ref|YP_009443313.1| photosystem II protein M (chloroplast) [Littledalea racemosa] ref|YP_009443603.1| photosystem II M protein (chloroplast) [Aconitum angustius] ref|YP_009443685.1| photosystem II M protein (chloroplast) [Aconitum finetianum] ref|YP_009443767.1| photosystem II M protein (chloroplast) [Aconitum sinomontanum] ref|YP_009443941.1| photosystem II protein M (chloroplast) [Forsythia suspensa] ref|YP_009444124.1| photosystem II protein M (chloroplast) [Quercus tarokoensis] ref|YP_009445146.1| photosystem II protein M (chloroplast) [Bertholletia excelsa] ref|YP_009445238.1| photosystem II protein M (chloroplast) [Primulina huaijiensis] ref|YP_009445325.1| photosystem II protein M (chloroplast) [Primulina linearifolia] ref|YP_009445754.1| photosystem II protein M (chloroplast) [Colobanthus apetalus] ref|YP_009444296.1| PSII low MW protein M (chloroplast) [Neofinetia falcata] ref|YP_009444370.1| PSII low MW protein M (chloroplast) [Neofinetia richardsiana] ref|YP_009446599.1| photosystem II protein M (chloroplast) [Adenocalymma aurantiacum] ref|YP_009446853.1| photosystem II protein M (chloroplast) [Adenocalymma cristicalyx] ref|YP_009446257.1| photosystem II protein M (chloroplast) [Symplocos ovatilobata] ref|YP_009446337.1| photosystem II protein M (chloroplast) [Saussurea polylepis] ref|YP_009446514.1| photosystem II protein M (chloroplast) [Adenocalymma allamandiflorum] ref|YP_009446684.1| photosystem II protein M (chloroplast) [Adenocalymma biternatum] ref|YP_009446768.1| photosystem II protein M (chloroplast) [Adenocalymma bracteatum] ref|YP_009446938.1| photosystem II protein M (chloroplast) [Adenocalymma hatschbachii] ref|YP_009447023.1| photosystem II protein M (chloroplast) [Adenocalymma pedunculatum] ref|YP_009447109.1| photosystem II protein M (chloroplast) [Adenocalymma peregrinum] ref|YP_009447192.1| photosystem II protein M (chloroplast) [Adenocalymma subspicatum] ref|YP_009447276.1| photosystem II protein M (chloroplast) [Neojobertia candolleana] ref|YP_009447354.1| photosystem II protein M (chloroplast) [Achyrachaena mollis] ref|YP_009450368.1| photosystem II reaction center M protein (chloroplast) [Saussurea chabyoungsanica] ref|YP_009450666.1| photosystem II protein M (chloroplast) [Streptogyna americana] ref|YP_009451340.1| photosystem II protein M (chloroplast) [Humbertochloa bambusiuscula] ref|YP_009451926.1| PsbM (chloroplast) [Phyllorachis sagittata] ref|YP_009452097.1| photosystem II protein M (chloroplast) [Rhipidocladum pittieri] ref|YP_009453684.1| photosystem II protein M (chloroplast) [Carpinus cordata] ref|YP_009453886.1| photosystem II protein M (chloroplast) [Przewalskia tangutica] ref|YP_009454626.1| photosystem II protein M (chloroplast) [Alnus cordata] ref|YP_009454711.1| photosystem II protein M (chloroplast) [Alnus incana] ref|YP_009454796.1| photosystem II protein M (chloroplast) [Alnus japonica] ref|YP_009454881.1| photosystem II protein M (chloroplast) [Alnus maximowiczii] ref|YP_009454966.1| photosystem II protein M (chloroplast) [Alnus nitida] ref|YP_009455051.1| photosystem II protein M (chloroplast) [Alnus orientalis] ref|YP_009455136.1| photosystem II protein M (chloroplast) [Alnus rubra] ref|YP_009455221.1| photosystem II protein M (chloroplast) [Alnus subcordata] ref|YP_009456784.1| photosystem II protein M (plastid) [Bergbambos tessellata] ref|YP_009457938.1| photosystem II protein M (chloroplast) [Camellia japonica] ref|YP_009456295.1| photosystem II protein M (chloroplast) [Ambrosia trifida] ref|YP_009456536.1| photosystem II protein M (plastid) [Oldeania alpina] ref|YP_009456619.1| photosystem II protein M (plastid) [Chimonobambusa tumidissinoda] ref|YP_009456702.1| photosystem II protein M (plastid) [Ampelocalamus actinotrichus] ref|YP_009456866.1| photosystem II protein M (plastid) [Oldeania humbertii] ref|YP_009456949.1| photosystem II protein M (plastid) [Oldeania ibityensis] ref|YP_009457032.1| photosystem II protein M (plastid) [Indocalamus sinicus] ref|YP_009457115.1| photosystem II protein M (plastid) [Indosasa shibataeoides] ref|YP_009457197.1| photosystem II protein M (plastid) [Oldeania itremoensis] ref|YP_009457280.1| photosystem II protein M (plastid) [Kuruna debilis] ref|YP_009457362.1| photosystem II protein M (plastid) [Oldeania cf. madagascariensis PFM-2018] ref|YP_009457445.1| photosystem II protein M (plastid) [Pseudosasa cantorii] ref|YP_009457527.1| photosystem II protein M (plastid) [Sasa longiligulata] ref|YP_009457610.1| photosystem II protein M (plastid) [Shibataea chiangshanensis] ref|YP_009458683.1| photosystem II protein M (chloroplast) [Fagus engleriana] ref|YP_009458767.1| photosystem II protein M (chloroplast) [Quercus glauca] ref|YP_009458958.1| photosystem II protein M (chloroplast) [Oryza coarctata] ref|YP_009459046.1| photosystem II protein M (chloroplast) [Amomum krervanh] ref|YP_009459133.1| photosystem II protein M (chloroplast) [Quercus tungmaiensis] ref|YP_009459520.1| photosystem II protein M (plastid) [Quercus sichourensis] ref|YP_009460248.1| photosystem II protein M (plastid) [Cardamine amara] ref|YP_009460333.1| photosystem II reaction center protein M (plastid) [Cardamine oligosperma] ref|YP_009460419.1| photosystem II reaction center protein M (plastid) [Cardamine parviflora] ref|YP_009460769.1| PSII M protein (plastid) [Galeopsis tetrahit] ref|YP_009461026.1| PSII M protein (plastid) [Lamium album] ref|YP_009461115.1| PSII M protein (plastid) [Lamium galeobdolon] ref|YP_009461465.1| photosystem II protein M (plastid) [Ranunculus repens] ref|YP_009461550.1| photosystem II protein M (plastid) [Ranunculus reptans] ref|YP_009461721.1| photosystem II protein M (chloroplast) [Chionanthus parkinsonii] ref|YP_009461809.1| photosystem II protein M (chloroplast) [Chionanthus rupicola] ref|YP_009461897.1| photosystem II protein M (chloroplast) [Forestiera isabelae] ref|YP_009461985.1| photosystem II protein M (chloroplast) [Forsythia x intermedia] ref|YP_009462072.1| photosystem II protein M (chloroplast) [Nestegis apetala] ref|YP_009462160.1| photosystem II protein M (chloroplast) [Noronhia lowryi] ref|YP_009462248.1| photosystem II protein M (chloroplast) [Olea exasperata] ref|YP_009462336.1| photosystem II protein M (chloroplast) [Schrebera arborea] ref|YP_009462424.1| photosystem II protein M (chloroplast) [Syringa vulgaris] ref|YP_009462805.1| photosystem II protein M (chloroplast) [Amomum compactum] ref|YP_009463086.1| photosystem II protein M (chloroplast) [Magnolia aromatica] ref|YP_009463172.1| photosystem II protein M (chloroplast) [Magnolia conifera] ref|YP_009463258.1| photosystem II protein M (chloroplast) [Magnolia duclouxii] ref|YP_009463344.1| photosystem II protein M (chloroplast) [Magnolia glaucifolia] ref|YP_009463430.1| photosystem II protein M (chloroplast) [Magnolia dandyi] ref|YP_009463516.1| photosystem II protein M (chloroplast) [Magnolia alba] ref|YP_009466321.1| photosystem II protein M (chloroplast) [Genlisea filiformis] ref|YP_009466396.1| photosystem II protein M (chloroplast) [Genlisea pygmaea] ref|YP_009466471.1| photosystem II protein M (chloroplast) [Genlisea repens] ref|YP_009466623.1| photosystem II protein M (chloroplast) [Genlisea violacea] ref|YP_009466701.1| photosystem II protein M (chloroplast) [Acrocomia aculeata] ref|YP_009467058.1| photosystem II protein M (chloroplast) [Schisandra sphenanthera] ref|YP_009467588.1| photosystem II protein M (chloroplast) [Prosphytochloa prehensilis] ref|YP_009468257.1| photosystem II protein M (chloroplast) [Drepanostachyum falcatum] ref|YP_009468601.1| photosystem II protein M (plastid) [Fraxinus chiisanensis] ref|YP_009468994.1| PsbM (chloroplast) [Streptocarpus teitensis] ref|YP_009469132.1| PsbM (chloroplast) [Asarum sieboldii] ref|YP_009469432.1| photosystem II protein M (chloroplast) [Anemoclema glaucifolium] ref|YP_009470651.1| photosystem II protein M (chloroplast) [Anemopaegma acutifolium] ref|YP_009470749.1| photosystem II protein M (chloroplast) [Anemopaegma album] ref|YP_009470847.1| photosystem II protein M (chloroplast) [Anemopaegma arvense] ref|YP_009470945.1| photosystem II protein M (chloroplast) [Anemopaegma chamberlaynii] ref|YP_009471043.1| photosystem II protein M (chloroplast) [Anemopaegma foetidum] ref|YP_009471141.1| photosystem II protein M (chloroplast) [Anemopaegma glaucum] ref|YP_009471239.1| photosystem II protein M (chloroplast) [Anemopaegma oligoneuron] ref|YP_009471622.1| photosystem II protein M (chloroplast) [Parrotia subaequalis] ref|YP_009471817.1| photosystem II M protein (chloroplast) [Mentha spicata] ref|AP_004922.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] sp|P62109.1|PSBM_ARATH RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|P62111.1|PSBM_TOBAC RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|P62112.1|PSBM_SPIOL RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q5IBK3.1|PSBM_PLALA RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q6ENI6.1|PSBM_ORYNI RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q6EW54.1|PSBM_NYMAL RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q7FNT0.1|PSBM_ATRBE RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q06H03.1|PSBM_DRIGR RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q06RD7.1|PSBM_JASNU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q09G52.1|PSBM_PLAOC RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q1KXX3.1|PSBM_HELAN RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q2MIA6.1|PSBM_SOLLC RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q2MIJ3.1|PSBM_SOLBU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q2VEI2.1|PSBM_SOLTU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q33C43.1|PSBM_NICTO RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q3BAP6.1|PSBM_PHAAO RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q3C1G4.1|PSBM_NICSY RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q3V540.1|PSBM_ACOCL RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q0G9M5.1|PSBM_LIRTU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|P0C411.1|PSBM_ORYSA RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|P0C412.1|PSBM_ORYSI RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|P0C413.1|PSBM_ORYSJ RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A7Y3C1.1|PSBM_IPOPU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QJS7.1|PSBM_OLIPU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QK99.1|PSBM_BARVE RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QKI6.1|PSBM_CAPBU RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QKS5.1|PSBM_CRUWA RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QLA0.1|PSBM_LEPVR RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QLS7.1|PSBM_NASOF RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A9L990.1|PSBM_LEMMI RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A6MM30.1|PSBM_BUXMI RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A6MMB6.1|PSBM_CHLSC RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A6MMK1.1|PSBM_DIOEL RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A6MMT8.1|PSBM_ILLOL RecName: Full=Photosystem II reaction center protein M; Short=PSII-M pdb|3JCU|M Chain M, Cryo-em Structure Of Spinach Psii-lhcii Supercomplex At 3.2 Angstrom Resolution pdb|3JCU|MM Chain m, Cryo-em Structure Of Spinach Psii-lhcii Supercomplex At 3.2 Angstrom Resolution pdb|5MDX|M Chain M, Cryo-em Structure Of The Psii Supercomplex From Arabidopsis Thaliana pdb|5MDX|MM Chain m, Cryo-em Structure Of The Psii Supercomplex From Arabidopsis Thaliana gb|AAM08591.1|AC092750_25 Putative PSII low MW protein from chromosome 10 chloroplast insertion [Oryza sativa Japonica Group] gb|AAM48256.1|AC122148_9 Putative PSII low MW protein from chromosome 10 chloroplast insertion [Oryza sativa Japonica Group] emb|CAA33984.1| PSII low MW protein (chloroplast) [Oryza sativa Japonica Group] emb|CAA77413.1| PSII M-protein (chloroplast) [Nicotiana tabacum] dbj|BAA84379.1| PSII low MW protein (chloroplast) [Arabidopsis thaliana] emb|CAB88719.1| PSII M-protein (chloroplast) [Spinacia oleracea] emb|CAC88038.1| PSII M protein (chloroplast) [Atropa belladonna] emb|CAD36619.1| photosystem II polypeptide M [Quercus petraea] dbj|BAD26766.1| PSII low MW protein (chloroplast) [Oryza nivara] emb|CAF28587.1| PSII low MW protein (chloroplast) [Nymphaea alba] gb|AAW33074.1| photosystem II protein M (chloroplast) [Plantago australis] gb|AAW33076.1| photosystem II protein M (chloroplast) [Plantago coronopus] gb|AAW33078.1| photosystem II protein M (chloroplast) [Plantago lanceolata] gb|AAW33080.1| photosystem II protein M (chloroplast) [Plantago media] gb|AAW33082.1| photosystem II protein M (chloroplast) [Plantago rigida] gb|AAW33084.1| photosystem II protein M (chloroplast) [Plantago rugelii] gb|AAW82497.1| photosystem II M protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] gb|AAZ04027.1| photosystem II protein M, partial (chloroplast) [Acorus americanus] gb|AAZ04029.1| photosystem II protein M, partial (chloroplast) [Nuphar advena] gb|AAZ04030.1| photosystem II protein M, partial (chloroplast) [Ranunculus macranthus] gb|AAZ04031.1| photosystem II protein M, partial (chloroplast) [Typha latifolia] gb|AAZ66142.1| PsbM (chloroplast) [Symplocos chinensis] gb|AAZ66144.1| PsbM (chloroplast) [Symplocos paniculata] gb|AAZ66148.1| PsbM (chloroplast) [Symplocos celastrinea] gb|AAZ66152.1| PsbM (chloroplast) [Symplocos pentandra] gb|AAZ66156.1| PsbM (chloroplast) [Symplocos tinctoria] gb|AAZ66158.1| PsbM (chloroplast) [Symplocos lanata] gb|AAZ66162.1| PsbM (chloroplast) [Symplocos austin-smithii] gb|AAZ66164.1| PsbM (chloroplast) [Symplocos austin-smithii] gb|AAZ66166.1| PsbM (chloroplast) [Symplocos austromexicana] gb|AAZ66168.1| PsbM (chloroplast) [Symplocos berteroi] gb|AAZ66170.1| PsbM (chloroplast) [Symplocos breedlovei] gb|AAZ66172.1| PsbM (chloroplast) [Symplocos citrea] gb|AAZ66174.1| PsbM (chloroplast) [Symplocos coccinea] gb|AAZ66176.1| PsbM (chloroplast) [Symplocos costaricana] gb|AAZ66178.1| PsbM (chloroplast) [Symplocos fuscata] gb|AAZ66180.1| PsbM (chloroplast) [Symplocos hartwegii] gb|AAZ66182.1| PsbM (chloroplast) [Symplocos limoncillo] gb|AAZ66184.1| PsbM (chloroplast) [Symplocos martinicensis] gb|AAZ66186.1| PsbM (chloroplast) [Symplocos matudae] gb|AAZ66188.1| PsbM (chloroplast) [Symplocos nitens] gb|AAZ66190.1| PsbM (chloroplast) [Symplocos povedae] gb|AAZ66196.1| PsbM (chloroplast) [Symplocos reflexa] gb|AAZ66198.1| PsbM (chloroplast) [Symplocos serrulata] gb|AAZ66204.1| PsbM (chloroplast) [Symplocos sp. Clark et al. 8252] gb|AAZ66208.1| PsbM (chloroplast) [Symplocos striata] gb|AAZ66210.1| PsbM (chloroplast) [Symplocos sulcinervia] gb|AAZ66214.1| PsbM (chloroplast) [Symplocos tribracteolata] gb|AAZ66216.1| PsbM (chloroplast) [Symplocos uniflora] gb|AAZ66218.1| PsbM (chloroplast) [Symplocos verrucisurcula] gb|AAZ66220.1| PsbM (chloroplast) [Symplocos candelabra] gb|AAZ66222.1| PsbM (chloroplast) [Symplocos falcata] gb|AAZ66224.1| PsbM (chloroplast) [Symplocos falcata] gb|AAZ66226.1| PsbM (chloroplast) [Symplocos organensis] gb|AAZ66228.1| PsbM (chloroplast) [Symplocos microstyla] gb|AAZ66232.1| PsbM (chloroplast) [Symplocos dryophila] gb|AAZ66234.1| PsbM (chloroplast) [Symplocos lancifolia] gb|AAZ66236.1| PsbM (chloroplast) [Symplocos macrophylla] gb|AAZ66242.1| PsbM (chloroplast) [Symplocos ovatilobata] gb|AAZ66252.1| PsbM (chloroplast) [Symplocos phyllocalyx] gb|AAZ66254.1| PsbM (chloroplast) [Symplocos setchuensis] gb|AAZ66256.1| PsbM (chloroplast) [Symplocos tetragona] gb|AAZ66258.1| PsbM (chloroplast) [Symplocos arborea] gb|AAZ66268.1| PsbM (chloroplast) [Symplocos sumuntia] gb|AAZ66272.1| PsbM (chloroplast) [Symplocos adenophylla] gb|AAZ66274.1| PsbM (chloroplast) [Symplocos congesta] gb|AAZ66276.1| PsbM (chloroplast) [Symplocos euryoides] gb|AAZ66282.1| PsbM (chloroplast) [Symplocos glomerata] gb|AAZ66284.1| PsbM (chloroplast) [Symplocos grandis] gb|AAZ66286.1| PsbM (chloroplast) [Symplocos stellaris] gb|AAZ66288.1| PsbM (chloroplast) [Symplocos caerulescens] emb|CAI53788.1| PSII low MW protein (plastid) [Acorus calamus] dbj|BAE46642.1| PSII M-protein (chloroplast) [Nicotiana sylvestris] dbj|BAE47992.1| PSII M-protein (chloroplast) [Nicotiana tomentosiformis] gb|ABB90037.1| photosystem II M protein (chloroplast) [Solanum tuberosum] gb|ABC56207.1| photosystem II protein M (chloroplast) [Solanum bulbocastanum] gb|ABC56294.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] gb|ABC60452.1| photosystem II protein M (chloroplast) [Nuphar advena] gb|ABC70750.1| photosystem II protein M (chloroplast) [Ranunculus macranthus] gb|ABD47051.1| photosystem II protein M (chloroplast) [Solanum tuberosum] gb|ABD47132.1| photosystem II protein M (chloroplast) [Helianthus annuus] gb|ABD48489.1| PSII M protein (chloroplast) [Lemna minor] emb|CAJ32387.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] gb|ABG74622.1| PSII M protein (chloroplast) [Jasminum nudiflorum] gb|ABH88291.1| photosystem II protein M (chloroplast) [Drimys granadensis] gb|ABI32503.1| photosystem II protein M (chloroplast) [Liriodendron tulipifera] gb|ABI49772.1| photosystem II protein M (chloroplast) [Platanus occidentalis] dbj|BAF49933.1| PSII low MW protein (chloroplast) [Olimarabidopsis pumila] dbj|BAF50104.1| PSII low MW protein (chloroplast) [Barbarea verna] dbj|BAF50191.1| PSII low MW protein (chloroplast) [Capsella bursa-pastoris] dbj|BAF50280.1| PSII low MW protein (chloroplast) [Crucihimalaya wallichii] dbj|BAF50455.1| PSII low MW protein (chloroplast) [Lepidium virginicum] dbj|BAF50632.1| PSII low MW protein (chloroplast) [Nasturtium officinale] gb|ABQ43254.1| photosystem II protein M (chloroplast) [Chloranthus spicatus] gb|ABQ45243.1| photosystem II protein M (chloroplast) [Buxus microphylla] gb|ABQ52513.1| photosystem II protein M (chloroplast) [Illicium oligandrum] gb|ABR01424.1| photosystem II protein M (chloroplast) [Dioscorea elephantipes] gb|ABU85342.1| photosystem II protein M, partial (chloroplast) [Elaeis oleifera] gb|ABU85434.1| photosystem II protein M, partial (chloroplast) [Musa acuminata] gb|ABU85580.1| photosystem II protein M, partial (chloroplast) [Scaevola aemula] gb|ABV02342.1| photosystem II protein M (chloroplast) [Ipomoea purpurea] gb|ABX38738.1| photosystem II protein M (chloroplast) [Acorus americanus] gb|ABY79726.1| photosystem II protein M (chloroplast) [Fagopyrum esculentum subsp. ancestrale] gb|ACB86513.1| photosystem II protein M (chloroplast) [Guizotia abyssinica] gb|ACN49317.1| photosystem II protein M (chloroplast) [Nelumbo lutea] gb|ACN49402.1| photosystem II protein M (chloroplast) [Nelumbo nucifera] gb|ACO92009.1| photosystem II protein M (chloroplast) [Megaleranthis saniculifolia] gb|ACS94666.1| PsbM (chloroplast) [Bambusa oldhamii] gb|ACT15394.1| photosystem II protein M (chloroplast) [Anomochloa marantoidea] gb|ACT99908.1| photosystem II protein M (chloroplast) [Dendrocalamus latiflorus] gb|ADA63693.1| photosystem II protein M (chloroplast) [Typha latifolia] gb|ADA69920.1| photosystem II protein M (chloroplast) [Olea europaea] gb|ADD30417.1| photosystem II protein M (chloroplast) [Antirrhinum majus] gb|ADD30419.1| photosystem II protein M (chloroplast) [Dillenia indica] gb|ADD30420.1| photosystem II protein M (chloroplast) [Ehretia acuminata] gb|ADD30421.1| photosystem II protein M (chloroplast) [Ilex cornuta] gb|ADD30423.1| photosystem II protein M (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|ADD30424.1| photosystem II protein M (chloroplast) [Nelumbo nucifera] gb|ADD30425.1| photosystem II protein M (chloroplast) [Nerium oleander] gb|ADD30429.1| photosystem II protein M (chloroplast) [Berberidopsis corallina] gb|ADD30434.1| photosystem II protein M (chloroplast) [Gunnera manicata] gb|ADD30437.1| photosystem II protein M (chloroplast) [Oxalis latifolia] gb|ADD30439.1| photosystem II protein M (chloroplast) [Quercus nigra] gb|ADD30441.1| photosystem II protein M (chloroplast) [Trochodendron aralioides] gb|ADD63166.1| photosystem II protein M (chloroplast) [Phoenix dactylifera] gb|ADD72083.1| photosystem II protein M (chloroplast) [Olea europaea] gb|ADF28140.1| photosystem II protein M (chloroplast) [Phoenix dactylifera] gb|ADL39050.1| photosystem II protein M (chloroplast) [Magnolia kwangsiensis] gb|ADN32880.1| photosystem II protein M (chloroplast) [Phyllostachys nigra var. henonis] gb|ADO33442.1| photosystem II protein M (plastid) [Smilax china] gb|ADO65054.1| photosystem II protein M (chloroplast) [Castanea mollissima] gb|ADO65131.1| photosystem II protein M (chloroplast) [Acidosasa purpurea] gb|ADO65214.1| photosystem II protein M (plastid) [Ferrocalamus rimosivaginus] gb|ADO65297.1| photosystem II protein M (plastid) [Indocalamus longiauritus] gb|ADO65379.1| photosystem II protein M (chloroplast) [Phyllostachys edulis] gb|ADO65463.1| photosystem II protein M (chloroplast) [Bambusa emeiensis] dbj|BAJ24022.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24023.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24024.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24025.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24026.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24027.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24028.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24029.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24030.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24031.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24032.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24033.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24034.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24035.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24036.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24037.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24038.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24039.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24040.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24041.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24042.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24043.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24044.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24045.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24046.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24047.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24048.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24049.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24050.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24051.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24052.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24053.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24054.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24055.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24056.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24057.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24058.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24059.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24060.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24061.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24062.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24063.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24064.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24065.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24066.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24067.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24068.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24069.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] dbj|BAJ24070.1| photosystem II protein M (chloroplast) [Lysionotus chingii] dbj|BAJ24071.1| photosystem II protein M (chloroplast) [Lysionotus chingii] dbj|BAJ24072.1| photosystem II protein M (chloroplast) [Lysionotus chingii] dbj|BAJ24073.1| photosystem II protein M (chloroplast) [Lysionotus oblongifolius] dbj|BAJ24074.1| photosystem II protein M (chloroplast) [Lysionotus oblongifolius] dbj|BAJ24075.1| photosystem II protein M (chloroplast) [Lysionotus oblongifolius] dbj|BAJ24076.1| photosystem II protein M (chloroplast) [Lysionotus denticulosus] dbj|BAJ24077.1| photosystem II protein M (chloroplast) [Lysionotus denticulosus] dbj|BAJ24078.1| photosystem II protein M (chloroplast) [Lysionotus serratus] gb|ADW94715.1| PsbM (plastid) [Streptocarpus papangae] gb|ADW94717.1| PsbM (plastid) [Streptocarpus montanus] gb|ADW94719.1| PsbM (plastid) [Streptocarpus fanniniae] gb|ADW94720.1| PsbM (plastid) [Streptocarpus pusillus] gb|ADW94722.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94724.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94726.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94728.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94730.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94732.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94734.1| PsbM (plastid) [Streptocarpus dunnii] gb|ADW94736.1| PsbM (plastid) [Streptocarpus denticulatus] gb|ADW94738.1| PsbM (plastid) [Streptocarpus denticulatus] gb|ADW94740.1| PsbM (plastid) [Streptocarpus grandis] gb|ADW94742.1| PsbM (plastid) [Streptocarpus grandis] gb|ADW94744.1| PsbM (plastid) [Streptocarpus vandeleurii] gb|ADW94746.1| PsbM (plastid) [Streptocarpus vandeleurii] gb|ADW94748.1| PsbM (plastid) [Streptocarpus rimicola] gb|ADW94750.1| PsbM (plastid) [Streptocarpus rimicola] gb|ADW94752.1| PsbM (plastid) [Streptocarpus bolusii] gb|ADW94754.1| PsbM (plastid) [Streptocarpus bolusii] gb|ADW94756.1| PsbM (plastid) [Streptocarpus porphyrostachys] gb|ADW94757.1| PsbM (plastid) [Streptocarpus polyanthus] gb|ADW94759.1| PsbM (plastid) [Streptocarpus saundersii] gb|ADW94761.1| PsbM (plastid) [Streptocarpus candidus] gb|ADW94763.1| PsbM (plastid) [Streptocarpus gardenii] gb|ADW94765.1| PsbM (plastid) [Streptocarpus gardenii] gb|ADW94767.1| PsbM (plastid) [Streptocarpus gardenii] gb|ADW94769.1| PsbM (plastid) [Streptocarpus gardenii] gb|ADW94771.1| PsbM (plastid) [Streptocarpus gardenii] gb|ADW94773.1| PsbM (plastid) [Streptocarpus gardenii] gb|ADW94774.1| PsbM (plastid) [Streptocarpus kentaniensis] gb|ADW94776.1| PsbM (plastid) [Streptocarpus lilliputana] gb|ADW94778.1| PsbM (plastid) [Streptocarpus lilliputana] gb|ADW94780.1| PsbM (plastid) [Streptocarpus aylae] gb|ADW94782.1| PsbM (plastid) [Streptocarpus caeruleus] gb|ADW94784.1| PsbM (plastid) [Streptocarpus caeruleus] gb|ADW94786.1| PsbM (plastid) [Streptocarpus longiflorus] gb|ADW94788.1| PsbM (plastid) [Streptocarpus parviflorus] gb|ADW94790.1| PsbM (plastid) [Streptocarpus parviflorus subsp. parviflorus] gb|ADW94792.1| PsbM (plastid) [Streptocarpus cyaneus subsp. nigridens] gb|ADW94794.1| PsbM (plastid) [Streptocarpus cyaneus] gb|ADW94796.1| PsbM (plastid) [Streptocarpus cyaneus] gb|ADW94798.1| PsbM (plastid) [Streptocarpus floribundus] gb|ADW94799.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94801.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94803.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94805.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94807.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94809.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94810.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94811.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94813.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94815.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94817.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94819.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94821.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94822.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94823.1| PsbM (plastid) [Streptocarpus meyeri] gb|ADW94832.1| PsbM (plastid) [Streptocarpus baudertii] gb|ADW94834.1| PsbM (plastid) [Streptocarpus johannis] gb|ADW94836.1| PsbM (plastid) [Streptocarpus johannis] gb|ADW94837.1| PsbM (plastid) [Streptocarpus johannis] gb|ADW94838.1| PsbM (plastid) [Streptocarpus johannis] gb|ADW94840.1| PsbM (plastid) [Streptocarpus modestus] gb|ADW94842.1| PsbM (plastid) [Streptocarpus modestus] gb|ADW94844.1| PsbM (plastid) [Streptocarpus formosus] gb|ADW94846.1| PsbM (plastid) [Streptocarpus formosus] gb|ADW94848.1| PsbM (plastid) [Streptocarpus formosus] gb|ADW94850.1| PsbM (plastid) [Streptocarpus formosus] gb|ADW94852.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94854.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94856.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94858.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94860.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94862.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94864.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94865.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94866.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94867.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94868.1| PsbM (plastid) [Streptocarpus primulifolius] gb|ADW94869.1| PsbM (plastid) [Streptocarpus rexii] gb|ADW94870.1| PsbM (plastid) [Streptocarpus rexii] gb|ADW94871.1| PsbM (plastid) [Streptocarpus rexii] gb|ADW94872.1| PsbM (plastid) [Streptocarpus rexii] gb|ADZ10863.1| photosystem II protein M (chloroplast) [Elaeis guineensis] emb|CBR30309.1| photosystem II protein M (plastid) [Olea europaea subsp. europaea] gb|AEB72133.1| photosystem II protein M (chloroplast) [Solanum tuberosum] gb|AEB72219.1| photosystem II protein M (chloroplast) [Solanum tuberosum] gb|AEB96294.1| photosystem II protein M (chloroplast) [Phalaenopsis equestris] gb|AEC03997.1| photosystem II protein M (chloroplast) [Silene conica] gb|AEC04078.1| photosystem II protein M (chloroplast) [Silene latifolia] gb|AEC04159.1| photosystem II protein M (chloroplast) [Silene noctiflora] gb|AEC04241.1| photosystem II protein M (chloroplast) [Silene vulgaris] emb|CBR23823.1| photosystem II protein M (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR24614.1| photosystem II protein M (chloroplast) [Olea europaea subsp. europaea] emb|CBR30400.1| photosystem II protein M (plastid) [Olea europaea subsp. europaea] emb|CBS29344.1| photosystem II protein M (chloroplast) [Olea woodiana subsp. woodiana] emb|CBS29231.1| photosystem II protein M (chloroplast) [Olea europaea subsp. maroccana] emb|CBJ04292.1| photosystem II protein M (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23732.1| photosystem II protein M (chloroplast) [Olea europaea subsp. cuspidata] gb|AEG64542.1| photosystem II protein M (chloroplast) [Ageratina adenophora] gb|AEI53005.1| photosystem II protein M (chloroplast) [Oryza meridionalis] gb|AEI53080.1| photosystem II protein M (chloroplast) [Oryza rufipogon] gb|AEI53157.1| photosystem II protein M (chloroplast) [Oryza rufipogon] gb|AEI70794.1| photosystem II protein M (chloroplast) [Puelia olyriformis] gb|AEK48400.1| photosystem II protein M (chloroplast) [Colocasia esculenta] gb|AEK48486.1| photosystem II protein M (chloroplast) [Colocasia esculenta] gb|AEK53223.1| photosystem II protein M (chloroplast) [Dorcoceras hygrometricum] gb|AEK94336.1| photosystem II protein M (chloroplast) [Spirodela polyrhiza] gb|AEK94419.1| photosystem II protein M (chloroplast) [Wolffiella lingulata] gb|AEK94502.1| photosystem II protein M (chloroplast) [Wolffia australiana] gb|AEM65212.1| PsbM (chloroplast) [Magnolia denudata] gb|AEO21166.1| photosystem II protein M (plastid) [Leersia tisserantii] gb|AEO21249.1| photosystem II protein M (chloroplast) [Phyllostachys propinqua] gb|AEO21332.1| photosystem II protein M (plastid) [Rhynchoryza subulata] gb|AEO92700.1| PSII M protein (chloroplast) [Sesamum indicum] gb|AEO95554.1| photosystem II protein M (chloroplast) [Nicotiana undulata] gb|AEO95664.1| photosystem II protein M [synthetic construct] gb|AEQ36932.1| photosystem II M protein (chloroplast) [Datura stramonium] gb|AEQ37018.1| photosystem II M protein (chloroplast) [Datura stramonium] gb|AER12808.1| photosystem II protein M (chloroplast) [Oryza sativa Indica Group] gb|AER12973.1| photosystem II protein M (chloroplast) [Oryza sativa Indica Group] dbj|BAL04669.1| photosystem II reaction center protein M (chloroplast) [Isodon shikokianus var. occidentalis] dbj|BAL04671.1| photosystem II reaction center protein M (chloroplast) [Isodon shikokianus var. intermedius] dbj|BAL04673.1| photosystem II reaction center protein M (chloroplast) [Isodon japonicus] dbj|BAL04675.1| photosystem II reaction center protein M (chloroplast) [Isodon trichocarpus] dbj|BAL04677.1| photosystem II reaction center protein M (chloroplast) [Isodon effusus] dbj|BAL04679.1| photosystem II reaction center protein M (chloroplast) [Isodon shikokianus var. intermedius] dbj|BAL04681.1| photosystem II reaction center protein M (chloroplast) [Isodon effusus] dbj|BAL04683.1| photosystem II reaction center protein M (chloroplast) [Isodon umbrosus] dbj|BAL04685.1| photosystem II reaction center protein M (chloroplast) [Isodon trichocarpus] dbj|BAL04687.1| photosystem II reaction center protein M (chloroplast) [Isodon inflexus] dbj|BAL04689.1| photosystem II reaction center protein M (chloroplast) [Isodon inflexus] dbj|BAL04691.1| photosystem II reaction center protein M (chloroplast) [Isodon shikokianus var. occidentalis] dbj|BAL04693.1| photosystem II reaction center protein M (chloroplast) [Isodon longitubus] dbj|BAL04695.1| photosystem II reaction center protein M (chloroplast) [Isodon japonicus] dbj|BAL04697.1| photosystem II reaction center protein M (chloroplast) [Isodon excisus] dbj|BAL04699.1| photosystem II reaction center protein M (chloroplast) [Isodon longitubus] gb|AEX37335.1| photosystem II protein M (chloroplast) [Arbutus unedo] gb|AEX65388.1| photosystem II protein M, partial (chloroplast) [Blossfeldia liliputana] gb|AEX65389.1| photosystem II protein M, partial (chloroplast) [Didierea madagascariensis] gb|AEX65391.1| photosystem II protein M, partial (chloroplast) [Mollugo verticillata] gb|AEX65394.1| photosystem II protein M, partial (chloroplast) [Pereskiopsis diguetii] gb|AEX98328.1| photosystem II M protein (chloroplast) [Magnolia denudata] gb|AEX98496.1| photosystem II M protein (chloroplast) [Magnolia officinalis] gb|AEX98578.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98662.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98746.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98913.1| photosystem II M protein (chloroplast) [Magnolia grandiflora] gb|AEX99081.1| photosystem II M protein (chloroplast) [Magnolia grandiflora] gb|AEY84646.1| photosystem II protein M (chloroplast) [Elodea canadensis] gb|AEZ01421.1| photosystem II protein M (chloroplast) [Japonolirion osense] gb|AFA26836.1| photosystem II protein M (plastid) [Albuca kirkii] gb|AFA26839.1| photosystem II protein M, partial (plastid) [Belosynapsis ciliata] gb|AFA26840.1| photosystem II protein M, partial (plastid) [Brocchinia micrantha] gb|AFA26841.1| photosystem II protein M (plastid) [Centrolepis monogyna] gb|AFA26842.1| photosystem II protein M, partial (plastid) [Chamaedorea seifrizii] gb|AFA26845.1| photosystem II protein M (plastid) [Dasypogon bromeliifolius] gb|AFA26849.1| photosystem II protein M, partial (plastid) [Fosterella caulescens] gb|AFA26855.1| photosystem II protein M (plastid) [Juncus effusus] gb|AFA26856.1| photosystem II protein M, partial (plastid) [Kingia australis] gb|AFA26859.1| photosystem II protein M, partial (plastid) [Navia saxicola] gb|AFA26861.1| photosystem II protein M, partial (plastid) [Neoregelia carolinae] gb|AFA26865.1| photosystem II protein M, partial (plastid) [Pitcairnia feliciana] gb|AFA26866.1| photosystem II protein M, partial (plastid) [Potarophytum riparium] gb|AFA26867.1| photosystem II protein M, partial (plastid) [Puya laxa] gb|AFA26868.1| photosystem II protein M, partial (plastid) [Ravenea hildebrandtii] gb|AFA26869.1| photosystem II protein M, partial (plastid) [Renealmia alpinia] gb|AFA26870.1| photosystem II protein M, partial (plastid) [Sparganium eurycarpum] gb|AFA26871.1| photosystem II protein M (plastid) [Syngonanthus chrysanthus] gb|AFA26872.1| photosystem II protein M (plastid) [Thamnochortus insignis] gb|AFA26874.1| photosystem II protein M, partial (plastid) [Tradescantia ohiensis] gb|AFH01441.1| photosystem II protein M (chloroplast) [Nelumbo nucifera] gb|AFH01535.1| photosystem II protein M (chloroplast) [Nelumbo lutea] gb|AFK81293.1| photosystem II protein M (plastid) [Camellia sinensis var. assamica] gb|AFK81380.1| photosystem II protein M (plastid) [Camellia oleifera] gb|AFK81467.1| photosystem II protein M (plastid) [Camellia taliensis] gb|AFM83287.1| photosystem II protein M (chloroplast) [Kingia australis] gb|AFM92273.1| photosystem II protein M (chloroplast) [Pachycladon cheesemanii] gb|AFP90770.1| photosystem II protein M (chloroplast) [Capsicum annuum] gb|AFP92303.1| photosystem II protein M (chloroplast) [Magnolia acuminata var. acuminata] gb|AFP92389.1| photosystem II protein M (chloroplast) [Magnolia cathcartii] gb|AFP92475.1| photosystem II protein M (chloroplast) [Magnolia macrophylla var. dealbata] gb|AFP92561.1| photosystem II protein M (chloroplast) [Magnolia denudata] gb|AFP92647.1| photosystem II protein M (chloroplast) [Magnolia pyramidata] gb|AFP92733.1| photosystem II protein M (chloroplast) [Magnolia kobus] gb|AFP92819.1| photosystem II protein M (chloroplast) [Magnolia liliiflora] gb|AFP92903.1| photosystem II protein M (chloroplast) [Magnolia odora] gb|AFP92991.1| photosystem II protein M (chloroplast) [Magnolia salicifolia] gb|AFP93077.1| photosystem II protein M (chloroplast) [Magnolia sinica] gb|AFP93163.1| photosystem II protein M (chloroplast) [Magnolia sprengeri] gb|AFQ30923.1| photosystem II M protein (chloroplast) [Salvia miltiorrhiza] gb|AFR25654.1| photosystem II protein M (chloroplast) [Penthorum chinense] gb|AFS67053.1| photosystem II protein M (chloroplast) [Arundinaria fargesii] gb|AFS67136.1| photosystem II protein M (chloroplast) [Sarocalamus faberi] gb|AFS67220.1| photosystem II protein M (chloroplast) [Chimonocalamus longiusculus] gb|AFS67302.1| photosystem II protein M (chloroplast) [Fargesia nitida] gb|AFS67385.1| photosystem II protein M (chloroplast) [Fargesia spathacea] gb|AFS67468.1| photosystem II protein M (chloroplast) [Fargesia yunnanensis] gb|AFS67551.1| photosystem II protein M (chloroplast) [Gaoligongshania megalothyrsa] gb|AFS67634.1| photosystem II protein M (chloroplast) [Gelidocalamus tessellatus] gb|AFS67717.1| photosystem II protein M (chloroplast) [Indocalamus wilsonii] gb|AFS67800.1| photosystem II protein M (chloroplast) [Indosasa sinica] gb|AFS67882.1| photosystem II protein M (chloroplast) [Oligostachyum shiuyingianum] gb|AFS67964.1| photosystem II protein M (chloroplast) [Pleioblastus maculatus] gb|AFS68046.1| photosystem II protein M (chloroplast) [Thamnocalamus spathiflorus] gb|AFS68129.1| photosystem II protein M (chloroplast) [Yushania levigata] gb|AFU93998.1| PsbM, partial (chloroplast) [Medusagyne oppositifolia] gb|AFU94006.1| PsbM, partial (chloroplast) [Rhizophora mangle] gb|AFV61808.1| PSII M protein (chloroplast) [Origanum vulgare subsp. vulgare] gb|AFY64181.1| photosystem II protein M (chloroplast) [Najas flexilis] gb|AGA55590.1| PSII M protein (chloroplast) [Camellia sinensis] emb|CCP47124.1| photosystem II protein M (chloroplast) [Tectona grandis] emb|CCP47213.1| photosystem II protein M (chloroplast) [Tectona grandis] emb|CCP47302.1| photosystem II protein M (chloroplast) [Tectona grandis] gb|AGC31240.1| photosystem II protein M (plastid) [Quercus rubra] gb|AGC38151.1| photosystem II protein M (chloroplast) [Arundinaria gigantea] gb|AGE65744.1| photosystem II protein M (chloroplast) [Pharus lappulaceus] gb|AGE92678.1| photosystem II protein M (plastid) [Heliconia collinsiana] gb|AGE92763.1| photosystem II protein M (plastid) [Zingiber spectabile] gb|AGE92848.1| photosystem II protein M (plastid) [Pseudophoenix vinifera] gb|AGE92934.1| photosystem II protein M (plastid) [Calamus caryotoides] gb|AGE93020.1| photosystem II protein M (plastid) [Bismarckia nobilis] gb|AGE93106.1| photosystem II protein M (plastid) [Dasypogon bromeliifolius] gb|AGE93278.1| photosystem II protein M (plastid) [Chamaedorea seifrizii] gb|AGE93364.1| photosystem II protein M (plastid) [Alpinia zerumbet] gb|AGE93450.1| photosystem II protein M (plastid) [Xiphidium caeruleum] emb|CCJ32511.1| PsbM (chloroplast) [Trithuria inconspicua] gb|AGH33761.1| photosystem II protein M (chloroplast) [Puelia olyriformis] gb|AGI51138.1| photosystem II protein M (chloroplast) [Catharanthus roseus] gb|AGJ51250.1| photosystem II protein M (chloroplast) [Solanum carolinense] gb|AGJ72051.1| photosystem II protein M (chloroplast) [Tetracentron sinense] gb|AGJ72143.1| photosystem II protein M (chloroplast) [Trochodendron aralioides] gb|AGL45330.1| PsbM (chloroplast) [Sesamum indicum] gb|AGL61069.1| photosystem II protein M (chloroplast) [Utricularia gibba] gb|AGL81771.1| photosystem II protein M (plastid) [Streptocarpus cooksonii] gb|AGL81773.1| photosystem II protein M (plastid) [Streptocarpus daviesii] gb|AGL81775.1| photosystem II protein M (plastid) [Streptocarpus daviesii] gb|AGL81777.1| photosystem II protein M (plastid) [Streptocarpus grandis] gb|AGL81779.1| photosystem II protein M (plastid) [Streptocarpus grandis] gb|AGL81781.1| photosystem II protein M (plastid) [Streptocarpus grandis] gb|AGL81783.1| photosystem II protein M (plastid) [Streptocarpus grandis] gb|AGL81785.1| photosystem II protein M (plastid) [Streptocarpus hilsenbergii] gb|AGL81787.1| photosystem II protein M (plastid) [Streptocarpus huamboensis] gb|AGL81789.1| photosystem II protein M (plastid) [Streptocarpus makabengensis] gb|AGL81791.1| photosystem II protein M (plastid) [Streptocarpus sp. MdV-2012] gb|AGL81793.1| photosystem II protein M (plastid) [Streptocarpus sp. MdV-2012] gb|AGL81795.1| photosystem II protein M (plastid) [Streptocarpus molweniensis] gb|AGL81797.1| photosystem II protein M (plastid) [Streptocarpus monophyllus] gb|AGL81799.1| photosystem II protein M (plastid) [Streptocarpus occultus] gb|AGL81801.1| photosystem II protein M (plastid) [Streptocarpus saundersii] gb|AGL81803.1| photosystem II protein M (plastid) [Streptocarpus wendlandii] gb|AGL81805.1| photosystem II protein M (plastid) [Streptocarpus wilmsii] gb|AGL81807.1| photosystem II protein M (plastid) [Streptocarpus monophyllus] emb|CCQ09096.1| photosystem II protein M (chloroplast) [Olea europaea subsp. europaea] gb|AGN72208.1| photosystem II protein M (chloroplast) [Arundinaria appalachiana] gb|AGN72291.1| photosystem II protein M (chloroplast) [Arundinaria tecta] gb|AGN73974.1| photosystem II M protein (chloroplast) [Aconitum barbatum var. puberulum] gb|AGO98518.1| photosystem II protein M (chloroplast) [Nelumbo nucifera] gb|AGQ55669.1| photosystem II protein M (chloroplast) [Alstroemeria aurea] emb|CCW72369.1| psbM (chloroplast) [Musa acuminata subsp. malaccensis] gb|AGS43460.1| photosystem II protein M (chloroplast) [Cocos nucifera] gb|AGT79840.1| PSII M protein (chloroplast) [Andrographis paniculata] gb|AGU44293.1| photosystem II protein M (chloroplast) [Camellia cuspidata] gb|AGU44378.1| photosystem II protein M (chloroplast) [Camellia danzaiensis] gb|AGU44469.1| photosystem II protein M (chloroplast) [Camellia impressinervis] gb|AGU44558.1| photosystem II protein M (chloroplast) [Camellia taliensis] gb|AGU44647.1| photosystem II protein M (chloroplast) [Camellia pitardii] gb|AGU44736.1| photosystem II protein M (chloroplast) [Camellia yunnanensis] gb|AGU44825.1| photosystem II protein M (chloroplast) [Camellia taliensis] gb|AGU46460.1| photosystem II protein M (plastid) [Hyoscyamus niger] gb|AGW96331.1| photosystem II protein M (chloroplast) [Ipomoea batatas] gb|AGW96416.1| photosystem II protein M (chloroplast) [Ipomoea batatas] gb|AGW96501.1| photosystem II protein M (chloroplast) [Ipomoea batatas] gb|AGW96586.1| photosystem II protein M (chloroplast) [Ipomoea trifida] gb|AGW96670.1| photosystem II protein M (chloroplast) [Argyreia nervosa] gb|AGW96755.1| photosystem II protein M (chloroplast) [Ipomoea amnicola] gb|AGW96840.1| photosystem II protein M (chloroplast) [Ipomoea argillicola] gb|AGW96925.1| photosystem II protein M (chloroplast) [Ipomoea cairica] gb|AGW97010.1| photosystem II protein M (chloroplast) [Ipomoea diamantinensis] gb|AGW97180.1| photosystem II protein M (chloroplast) [Ipomoea eriocarpa] gb|AGW97265.1| photosystem II protein M (chloroplast) [Ipomoea hederifolia] gb|AGW97350.1| photosystem II protein M (chloroplast) [Ipomoea involucrata] gb|AGW97435.1| photosystem II protein M (chloroplast) [Ipomoea murucoides] gb|AGW97520.1| photosystem II protein M (chloroplast) [Ipomoea nil] gb|AGW97605.1| photosystem II protein M (chloroplast) [Ipomoea orizabensis] gb|AGW97690.1| photosystem II protein M (chloroplast) [Ipomoea pedicellaris] gb|AGW97775.1| photosystem II protein M (chloroplast) [Ipomoea pes-caprae] gb|AGW97860.1| photosystem II protein M (chloroplast) [Ipomoea polpha] gb|AGW97945.1| photosystem II protein M (chloroplast) [Ipomoea setosa] gb|AGW98029.1| photosystem II protein M (chloroplast) [Ipomoea splendor-sylvae] gb|AGW98114.1| photosystem II protein M (chloroplast) [Ipomoea ternifolia] gb|AGW98199.1| photosystem II protein M (chloroplast) [Ipomoea tricolor] gb|AGW98284.1| photosystem II protein M (chloroplast) [Ipomoea trifida] gb|AGW98369.1| photosystem II protein M (chloroplast) [Ipomoea cordatotriloba] gb|AGW98454.1| photosystem II protein M (chloroplast) [Ipomoea minutiflora] gb|AGW98539.1| photosystem II protein M (chloroplast) [Ipomoea obscura] gb|AGW98624.1| photosystem II protein M (chloroplast) [Ipomoea pes-tigridis] gb|AGW98709.1| photosystem II protein M (chloroplast) [Merremia quinquefolia] gb|AGW98794.1| photosystem II protein M (chloroplast) [Operculina macrocarpa] gb|AGW98879.1| photosystem II protein M (chloroplast) [Stictocardia macalusoi] gb|AGW98964.1| photosystem II protein M (chloroplast) [Turbina corymbosa] gb|AGX29600.1| photosystem II protein M (chloroplast) [Aster spathulifolius] gb|AGY93097.1| photosystem II protein M (chloroplast) [Oryza nivara] gb|AGY93184.1| photosystem II protein M (chloroplast) [Oryza rufipogon] gb|AGY93271.1| photosystem II protein M (chloroplast) [Oryza glaberrima] gb|AGY93358.1| photosystem II protein M (chloroplast) [Oryza barthii] gb|AGY93445.1| photosystem II protein M (chloroplast) [Oryza glumipatula] gb|AGY93532.1| photosystem II protein M (chloroplast) [Oryza meridionalis] gb|AGY93619.1| photosystem II protein M (chloroplast) [Oryza longistaminata] gb|AGY93706.1| photosystem II protein M (chloroplast) [Oryza punctata] gb|AGY93793.1| photosystem II protein M (chloroplast) [Oryza minuta] gb|AGY93880.1| photosystem II protein M (chloroplast) [Oryza officinalis] gb|AGY93967.1| photosystem II protein M (chloroplast) [Oryza rhizomatis] gb|AGY94054.1| photosystem II protein M (chloroplast) [Oryza eichingeri] gb|AGY94315.1| photosystem II protein M (chloroplast) [Oryza latifolia] gb|AGY94402.1| photosystem II protein M (chloroplast) [Oryza australiensis] gb|AGY94489.1| photosystem II protein M (chloroplast) [Oryza brachyantha] gb|AGY94575.1| photosystem II protein M (chloroplast) [Oryza longiglumis] gb|AGY94663.1| photosystem II protein M (chloroplast) [Oryza ridleyi] gb|AGY94750.1| photosystem II protein M (chloroplast) [Oryza meyeriana var. granulata] gb|AGY94837.1| photosystem II protein M (chloroplast) [Oryza meyeriana] gb|AGY94923.1| photosystem II protein M (chloroplast) [Leersia japonica] gb|AGZ13228.1| photosystem II protein M (plastid) [Olyra latifolia] gb|AGZ17999.1| photosystem II protein M (chloroplast) [Silene conoidea] gb|AGZ18080.1| photosystem II protein M (chloroplast) [Silene chalcedonica] gb|AGZ18160.1| photosystem II protein M (chloroplast) [Silene paradoxa] gb|AGZ19137.1| photosystem II protein M (chloroplast) [Camellia sinensis] gb|AGZ19202.1| photosystem II protein M (chloroplast) [Oryza rufipogon] emb|CDI43912.1| photosystem II protein M (chloroplast) [Lindenbergia philippensis] gb|AHA12508.1| photosystem II protein M (plastid) [Musa textilis] gb|AHA12594.1| photosystem II protein M (plastid) [Ravenala madagascariensis] gb|AHA12677.1| photosystem II protein M (plastid) [Orchidantha fimbriata] gb|AHA12749.1| photosystem II protein M (plastid) [Canna indica] gb|AHA12833.1| photosystem II protein M (plastid) [Maranta leuconeura] gb|AHA12918.1| photosystem II protein M (plastid) [Monocostus uniflorus] gb|AHA13004.1| photosystem II protein M (plastid) [Costus pulverulentus] gb|AHA13090.1| photosystem II protein M (plastid) [Curcuma roscoeana] gb|AHA13176.1| photosystem II protein M (plastid) [Thaumatococcus daniellii] gb|AHA84923.1| photosystem II protein M (plastid) [Ajuga reptans] gb|AHB14443.1| photosystem II protein M (plastid) [Helianthus giganteus] gb|AHB14528.1| photosystem II protein M (plastid) [Helianthus giganteus] gb|AHB14613.1| photosystem II protein M (plastid) [Helianthus giganteus] gb|AHB14698.1| photosystem II protein M (plastid) [Helianthus giganteus] gb|AHB14783.1| photosystem II protein M (plastid) [Helianthus grosseserratus] gb|AHB14868.1| photosystem II protein M (plastid) [Helianthus grosseserratus] gb|AHB14953.1| photosystem II protein M (plastid) [Helianthus divaricatus] gb|AHB15038.1| photosystem II protein M (plastid) [Helianthus divaricatus] gb|AHB15123.1| photosystem II protein M (plastid) [Helianthus divaricatus] gb|AHB15208.1| photosystem II protein M (plastid) [Helianthus divaricatus] gb|AHB15293.1| photosystem II protein M (plastid) [Helianthus decapetalus] gb|AHB15378.1| photosystem II protein M (plastid) [Helianthus decapetalus] gb|AHB15463.1| photosystem II protein M (plastid) [Helianthus decapetalus] gb|AHB15548.1| photosystem II protein M (plastid) [Helianthus hirsutus] gb|AHB15633.1| photosystem II protein M (plastid) [Helianthus hirsutus] gb|AHB15718.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AHB15803.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AHB15888.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AHB15973.1| photosystem II protein M (plastid) [Helianthus divaricatus] gb|AHB16058.1| photosystem II protein M (plastid) [Helianthus giganteus] gb|AHB16143.1| photosystem II protein M (plastid) [Helianthus giganteus] gb|AHB16228.1| photosystem II protein M (plastid) [Helianthus grosseserratus] gb|AHB16313.1| photosystem II protein M (plastid) [Helianthus grosseserratus] gb|AHB16398.1| photosystem II protein M (plastid) [Helianthus grosseserratus] gb|AHB16483.1| photosystem II protein M (plastid) [Helianthus grosseserratus] gb|AHB16568.1| photosystem II protein M (plastid) [Helianthus decapetalus] gb|AHB16653.1| photosystem II protein M (plastid) [Helianthus decapetalus] gb|AHB16738.1| photosystem II protein M (plastid) [Helianthus decapetalus] gb|AHB16823.1| photosystem II protein M (plastid) [Helianthus hirsutus] gb|AHB16908.1| photosystem II protein M (plastid) [Helianthus hirsutus] gb|AHB16993.1| photosystem II protein M (plastid) [Helianthus strumosus] gb|AHB17078.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AHB17163.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AHB17248.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AHB17333.1| photosystem II protein M (plastid) [Helianthus maximiliani] gb|AHB17418.1| photosystem II protein M (plastid) [Helianthus maximiliani] gb|AHB17503.1| photosystem II protein M (plastid) [Helianthus maximiliani] gb|AHB17588.1| photosystem II protein M (plastid) [Helianthus maximiliani] emb|CDJ38613.1| photosystem II protein M (chloroplast) [Schwalbea americana] gb|AHB38648.1| photosystem II protein M (chloroplast) [Trithuria filamentosa] gb|AHF71634.1| photosystem II protein M (chloroplast) [Camellia crapnelliana] gb|AHF71722.1| photosystem II protein M (chloroplast) [Nymphaea mexicana] gb|AHF72166.1| photosystem II protein M (chloroplast) [Magnolia yunnanensis] emb|CCQ71614.1| photosystem II protein M (chloroplast) [Salvia miltiorrhiza] emb|CDL78808.1| photosystem II protein M (chloroplast) [Pinguicula ehlersiae] gb|AHH24327.1| photosystem II protein M (chloroplast) [Japonolirion osense] gb|AHH30435.1| photosystem II protein M (chloroplast) [Neobartsia inaequalis] gb|AHI45608.1| photosystem II protein M (plastid) [Sabal domingensis] gb|AHI87521.1| photosystem II protein M (chloroplast) [Chionographis japonica] gb|AHL16901.1| photosystem II protein M (chloroplast) [Castanopsis echinocarpa] gb|AHM02389.1| photosystem II protein M (chloroplast) [Praxelis clematidea] gb|AHN07164.1| photosystem II protein M (plastid) [Cardamine impatiens] gb|AHN07249.1| photosystem II protein M (plastid) [Cardamine resedifolia] gb|AHN16119.1| photosystem II protein M (chloroplast) [Trigonobalanus doichangensis] gb|AHW51952.1| photosystem II protein M (plastid) [Magnolia tripetala] gb|AHW52178.1| photosystem II protein M (chloroplast) [Rhazya stricta] gb|AHY86169.1| photosystem II protein M (plastid) [Ampelocalamus calcareus] gb|AHZ18125.1| photosystem II protein M (plastid) [Dioscorea rotundata] gb|AHZ42965.1| photosystem II protein M (chloroplast) [Cypripedium formosanum] gb|AHZ60699.1| photosystem II protein M (plastid) [Oryza glaberrima] gb|AHZ61367.1| photosystem II protein M (plastid) [Bergbambos tessellata] gb|AIA24166.1| photosystem II protein M (plastid) [Indocalamus sinicus] gb|AIA24211.1| photosystem II protein M (plastid) [Oldeania alpina] gb|AIA76956.1| photosystem II protein M (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum] gb|AIB08727.1| photosystem II protein M (plastid) [Rhazya stricta] gb|AIC37268.1| photosystem II protein M (plastid) [Cypripedium japonicum] gb|AIE44563.1| photosystem II protein M (chloroplast) [Oryza australiensis] gb|AIG61247.1| photosystem II protein M (chloroplast) [Camellia grandibracteata] gb|AIG61334.1| photosystem II protein M (chloroplast) [Camellia leptophylla] gb|AIG61421.1| photosystem II protein M (chloroplast) [Camellia petelotii] gb|AIG61508.1| photosystem II protein M (chloroplast) [Camellia pubicosta] gb|AIG61595.1| photosystem II protein M (chloroplast) [Camellia reticulata] gb|AIG61683.1| photosystem II protein M (chloroplast) [Camellia sinensis var. dehungensis] gb|AIG61770.1| photosystem II protein M (chloroplast) [Camellia sinensis var. pubilimba] gb|AIG61857.1| photosystem II protein M (chloroplast) [Camellia sinensis var. sinensis] gb|AIH00226.1| photosystem II protein M (chloroplast) [Bambusa multiplex] gb|AIH00311.1| photosystem II protein M (chloroplast) [Phyllostachys sulphurea] gb|AIM52856.1| photosystem II protein M (plastid) [Bambusa bambos] gb|AIM52940.1| photosystem II protein M (plastid) [Bambusa arnhemica] gb|AIM53024.1| photosystem II protein M (plastid) [Chusquea spectabilis] gb|AIM53108.1| photosystem II protein M (plastid) [Diandrolyra sp. Clark 1301] gb|AIM53188.1| photosystem II protein M (plastid) [Eremitis sp. Clark & Zhang 1343] gb|AIM53268.1| photosystem II protein M (plastid) [Greslania sp. McPherson 19217] gb|AIM53352.1| photosystem II protein M (plastid) [Hickelia madagascariensis] gb|AIM53436.1| photosystem II protein M (plastid) [Neohouzeaua sp. Clark & Attigala 1712] gb|AIM53520.1| photosystem II protein M (plastid) [Neololeba atra] gb|AIM53604.1| photosystem II protein M (plastid) [Olmeca reflexa] gb|AIM53688.1| photosystem II protein M (plastid) [Raddia brasiliensis] gb|AIM53856.1| photosystem II protein M (plastid) [Buergersiochloa bambusoides] gb|AIM53939.1| photosystem II protein M (plastid) [Chusquea liebmannii] gb|AIM54022.1| photosystem II protein M (plastid) [Lithachne pauciflora] gb|AIM54102.1| photosystem II protein M (plastid) [Otatea acuminata] gb|AIM54186.1| photosystem II protein M (plastid) [Pariana radiciflora] gb|AIM54266.1| photosystem II protein M (plastid) [Thamnocalamus spathiflorus] gb|AIN81003.1| photosystem II protein M (chloroplast) [Zingiber officinale] gb|AIP85225.1| PsbM (chloroplast) [Camellia sinensis] gb|AIQ81091.1| photosystem II protein M (chloroplast) [Clematis terniflora] gb|AIR12597.1| photosystem II protein M (plastid) [Bomarea edulis] gb|AIS67526.1| photosystem II protein M (chloroplast) [Phragmipedium longifolium] gb|AIT15986.1| photosystem II protein M (chloroplast) [Luzuriaga radicans] gb|AIU44765.1| photosystem II protein M (chloroplast) [Phalaenopsis hybrid cultivar] gb|AIU98530.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] emb|CDI43995.1| photosystem II protein M (chloroplast) [Genlisea margaretae] emb|CDL78730.1| photosystem II protein M (chloroplast) [Utricularia macrorhiza] gb|AIW05429.1| photosystem II protein M (plastid) [Neobracea bahamensis] gb|AIW05514.1| photosystem II protein M (plastid) [Nerium oleander] gb|AIW05938.1| photosystem II protein M (plastid) [Wrightia natalensis] gb|AIW51833.1| photosystem II protein M (chloroplast) [Lasthenia burkei] gb|AIW56411.1| photosystem II protein M (chloroplast) [Xerophyllum tenax] gb|AIW56498.1| photosystem II protein M (chloroplast) [Heloniopsis tubiflora] gb|AIX03510.1| photosystem II protein M (plastid) [Thalictrum coreanum] gb|AIX89737.1| PsbM (chloroplast) [Fagopyrum tataricum] emb|CED79756.1| photosystem II protein M (chloroplast) [Hesperelaea palmeri] gb|AIY33816.1| photosystem II protein M (chloroplast) [Nelumbo nucifera] gb|AIY72374.1| PsbM (chloroplast) [Carthamus tinctorius] gb|AIZ57527.1| photosystem II protein M (chloroplast) [Clematis fusca var. coreana] gb|AJA05711.1| photosystem II protein M (plastid) [Castanea pumila var. pumila] gb|AJA38265.1| photosystem II protein M (chloroplast) [Diospyros glaucifolia] gb|AJA39738.1| photosystem II protein M (chloroplast) [Guadua angustifolia] gb|AJC09129.1| PsbM (chloroplast) [Oryza sativa Indica Group] gb|AJC09228.1| PsbM (chloroplast) [Oryza sativa Indica Group] gb|AJC09327.1| PsbM (chloroplast) [Oryza sativa] gb|AJC09427.1| PsbM (chloroplast) [Oryza glaberrima] gb|AJC09527.1| PsbM (chloroplast) [Oryza barthii] gb|AJC09627.1| PsbM (chloroplast) [Oryza rufipogon] gb|AJC09727.1| PsbM (chloroplast) [Oryza meridionalis] gb|AJC09827.1| PsbM (chloroplast) [Oryza glumipatula] gb|AJC09927.1| PsbM (chloroplast) [Oryza punctata] gb|AJC10101.1| PsbM (chloroplast) [Oryza glaberrima] gb|AJC10201.1| PsbM (chloroplast) [Oryza barthii] gb|AJC10301.1| PsbM (chloroplast) [Oryza barthii] gb|AJC10401.1| PsbM (chloroplast) [Oryza barthii] gb|AJC10501.1| PsbM (chloroplast) [Oryza barthii] gb|AJC10601.1| PsbM (chloroplast) [Oryza sativa Indica Group] gb|AJC99301.1| PsbM (chloroplast) [Oryza sativa Japonica Group] gb|AJC99390.1| PsbM (chloroplast) [Oryza sativa Japonica Group] gb|AJC99731.1| PsbM (chloroplast) [Oryza glaberrima] gb|AJC99831.1| PsbM (chloroplast) [Oryza nivara] gb|AJC99931.1| PsbM (chloroplast) [Oryza barthii] gb|AJD00032.1| PsbM (chloroplast) [Oryza longistaminata] dbj|BAQ19635.1| photosystem II protein M (chloroplast) [Ananas comosus] gb|AJD76815.1| photosystem II protein M (chloroplast) [Lathraea squamaria] gb|AJE28368.1| photosystem II protein M (chloroplast) [Premna microphylla] gb|AJE71211.1| photosystem II protein M (plastid) [Acorus gramineus] gb|AJE73083.1| photosystem II protein M (plastid) [Xanthisma spinulosum] gb|AJE73159.1| photosystem II protein M (plastid) [Gutierrezia sarothrae] gb|AJE73235.1| photosystem II protein M (plastid) [Liatris squarrosa] gb|AJE73387.1| photosystem II protein M (plastid) [Erigeron strigosus] gb|AJE73539.1| photosystem II protein M (plastid) [Cirsium undulatum] gb|AJE73615.1| photosystem II protein M (plastid) [Solidago canadensis var. scabra] gb|AJE73691.1| photosystem II protein M (plastid) [Erigeron philadelphicus] gb|AJE73767.1| photosystem II protein M (plastid) [Heterotheca stenophylla] gb|AJE73919.1| photosystem II protein M (plastid) [Vernonia baldwinii] gb|AJE73995.1| photosystem II protein M (plastid) [Helenium flexuosum] gb|AJE74071.1| photosystem II protein M (plastid) [Heterotheca villosa] gb|AJE74147.1| photosystem II protein M (plastid) [Cirsium altissimum] gb|AJE74223.1| photosystem II protein M (plastid) [Echinacea angustifolia] gb|AJE74299.1| photosystem II protein M (plastid) [Helianthus petiolaris] gb|AJE74603.1| photosystem II protein M (plastid) [Ratibida columnifera] gb|AJE74679.1| photosystem II protein M (plastid) [Lygodesmia juncea] gb|AJE74755.1| photosystem II protein M (plastid) [Hymenopappus tenuifolius] gb|AJE74831.1| photosystem II protein M (plastid) [Cirsium canescens] gb|AJE74907.1| photosystem II protein M (plastid) [Solidago gigantea] gb|AJE75059.1| photosystem II protein M (plastid) [Erigeron bellidiastrum] gb|AJE75135.1| photosystem II protein M (plastid) [Tragopogon dubius] gb|AJF94036.1| photosystem II protein M (chloroplast) [Diospyros sp. LHM-2015] gb|AJF94123.1| photosystem II protein M (chloroplast) [Diospyros lotus] gb|AJF94210.1| photosystem II protein M (chloroplast) [Diospyros oleifera] gb|AJK90741.1| photosystem II protein M (chloroplast) [Capsicum lycianthoides] gb|AJL34403.1| photosystem II protein M (chloroplast) [Dunalia obovata] gb|AJM70051.1| photosystem II protein M (chloroplast) [Chloranthus japonicus] gb|AJM70094.1| photosystem II protein M (chloroplast) [Iochroma nitidum] gb|AJN90300.1| photosystem II protein M (plastid) [Physalis peruviana] gb|AJN90406.1| photosystem II protein M (chloroplast) [Phyllostachys edulis] gb|AJN90500.1| photosystem II protein M (chloroplast) [Iochroma stenanthum] gb|AJN91009.1| photosystem II protein M (plastid) [Lithocarpus balansae] gb|AJO25106.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] gb|AJO25283.1| PSII M protein (chloroplast) [Diplopanax stachyanthus] gb|AJO26081.1| photosystem II protein M (chloroplast) [Actinidia chinensis] gb|AJO26164.1| photosystem II protein M (chloroplast) [Actinidia chinensis] gb|AJO26247.1| photosystem II protein M (chloroplast) [Actinidia deliciosa] gb|AJO26330.1| photosystem II protein M (chloroplast) [Actinidia chinensis] gb|AJO61575.1| photosystem II protein M (chloroplast) [Saracha punctata] gb|AJP09557.1| photosystem II protein M (chloroplast) [Ipomoea batatas] gb|AJP33663.1| photosystem II protein M (chloroplast) [Oryza barthii] gb|AJP33745.1| photosystem II protein M (chloroplast) [Oryza barthii] gb|AJP33827.1| photosystem II protein M (chloroplast) [Oryza barthii] gb|AJP33909.1| photosystem II protein M (chloroplast) [Oryza barthii] gb|AJP33992.1| photosystem II protein M (chloroplast) [Oryza glaberrima] gb|AJP34073.1| photosystem II protein M (chloroplast) [Oryza glaberrima] gb|AJP34156.1| photosystem II protein M (chloroplast) [Oryza glumipatula] gb|AJP34239.1| photosystem II protein M (chloroplast) [Oryza longistaminata] gb|AJP34322.1| photosystem II protein M (chloroplast) [Oryza longistaminata] gb|AJP34405.1| photosystem II protein M (chloroplast) [Oryza officinalis] gb|AJR30373.1| photosystem II protein M (chloroplast) [Vassobia breviflora] gb|AJR32894.1| photosystem II protein M (chloroplast) [Dunalia spinosa] gb|AJS14248.1| photosystem II protein M (chloroplast) [Iochroma loxense] gb|AJS14332.1| photosystem II protein M (chloroplast) [Iochroma calycinum] gb|AJS14413.1| photosystem II protein M (plastid) [Ruellia breedlovei] gb|AJS14499.1| photosystem II protein M (plastid) [Iochroma australe] gb|AJV88590.1| photosystem II protein M (chloroplast) [Carludovica palmata] gb|AJV89101.1| photosystem II protein M (plastid) [Avena sativa] gb|AJV89267.1| photosystem II protein M (plastid) [Brachyelytrum aristosum] gb|AJV89604.1| photosystem II protein M (plastid) [Diarrhena obovata] gb|AJV89853.1| photosystem II protein M (plastid) [Melica mutica] gb|AJV89936.1| photosystem II protein M (plastid) [Melica subulata] gb|AJV90103.1| photosystem II protein M (plastid) [Phaenosperma globosum] gb|AJV90186.1| photosystem II protein M (plastid) [Phalaris arundinacea] gb|AJW59573.1| photosystem II protein M (chloroplast) [Ilex dumosa] gb|AJW59616.1| photosystem II protein M (chloroplast) [Ilex paraguariensis] gb|AJW60142.1| photosystem II protein M (chloroplast) [Quercus aliena] gb|AJW75044.1| photosystem II protein M (chloroplast) [Vassobia dichotoma] gb|AJY78686.1| photosystem II protein M (chloroplast) [Solanum cheesmaniae] gb|AJY78769.1| photosystem II protein M (chloroplast) [Solanum chilense] gb|AJY78852.1| photosystem II protein M (chloroplast) [Solanum galapagense] gb|AJY78935.1| photosystem II protein M (chloroplast) [Solanum habrochaites] gb|AJY79018.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] gb|AJY79101.1| photosystem II protein M (chloroplast) [Solanum neorickii] gb|AJY79184.1| photosystem II protein M (chloroplast) [Solanum peruvianum] gb|AJY79267.1| photosystem II protein M (chloroplast) [Solanum pimpinellifolium] gb|AKA66526.1| photosystem II protein M (chloroplast) [Dunalia brachyacantha] gb|AKA66957.1| photosystem II protein M (chloroplast) [Quercus spinosa] gb|AKB92921.1| photosystem II protein M (chloroplast) [Colchicum autumnale] gb|AKB93007.1| photosystem II protein M (chloroplast) [Gloriosa superba] gb|AKC05463.1| photosystem II protein M (chloroplast) [Quercus aquifolioides] gb|AKE07330.1| photosystem II protein M (plastid) [Guadua weberbaueri] gb|AKF00569.1| photosystem II protein M (chloroplast) [Reinhardtia paiewonskiana] gb|AKF00832.1| photosystem II protein M (chloroplast) [Veitchia spiralis] gb|AKF00918.1| photosystem II protein M (chloroplast) [Areca vestiaria] gb|AKF01984.1| photosystem II protein M (chloroplast) [Manicaria saccifera] gb|AKF33684.1| photosystem II protein M (chloroplast) [Dioscorea zingiberensis] gb|AKF78406.1| photosystem II protein M (chloroplast) [Dunalia solanacea] gb|AKG49782.1| photosystem II protein M (chloroplast) [Cynara humilis] gb|AKH02193.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKH02313.1| photosystem II protein M (chloroplast) [Iochroma tingoanum] gb|AKH04419.1| photosystem II protein M (plastid) [Chusquea circinata] gb|AKH04503.1| photosystem II protein M (plastid) [Chusquea sp. PFM-2015] gb|AKH04587.1| photosystem II protein M (plastid) [Otatea glauca] gb|AKH04671.1| photosystem II protein M (plastid) [Pariana campestris] gb|AKH04754.1| photosystem II protein M (plastid) [Pariana radiciflora] gb|AKH04837.1| photosystem II protein M (plastid) [Pariana sp. PFM-2015] gb|AKH49622.1| photosystem II protein M (chloroplast) [Chikusichloa aquatica] gb|AKJ25292.1| photosystem II protein M (plastid) [Carex siderosticta] gb|AKJ76797.1| PSII M protein (chloroplast) [Salvia rosmarinus] gb|AKJ77211.1| photosystem II M protein (chloroplast) [Scutellaria baicalensis] gb|AKJ77478.1| photosystem II protein M (chloroplast) [Carthamus tinctorius] gb|AKJ77557.1| photosystem II protein M (chloroplast) [Dioscorea nipponica] gb|AKJ77638.1| photosystem II protein M (chloroplast) [Fagopyrum cymosum] gb|AKJ77735.1| photosystem II protein M (chloroplast) [Perilla frutescens] gb|AKJ83505.1| photosystem II protein M (chloroplast) [Dieffenbachia seguine] gb|AKJ83761.1| photosystem II protein M (chloroplast) [Pinellia ternata] gb|AKJ85808.1| photosystem II protein M (chloroplast) [Podococcus barteri] gb|AKM21331.1| PSII M protein (chloroplast) [Pogostemon yatabeanus] gb|AKM21418.1| PSII M protein (chloroplast) [Pogostemon stellatus] gb|AKM21506.1| PSII M protein (chloroplast) [Paulownia coreana] gb|AKM21593.1| PSII M protein (chloroplast) [Paulownia tomentosa] gb|AKM21853.1| PsbM (chloroplast) [Solanum commersonii] gb|AKM21939.1| PsbM (chloroplast) [Solanum nigrum] gb|AKM22025.1| PsbM (chloroplast) [Solanum tuberosum] gb|AKM98154.1| photosystem II M protein (chloroplast) [Anemone patens] gb|AKM98242.1| photosystem II M protein (chloroplast) [Anemone patens] gb|AKM98330.1| photosystem II M protein (chloroplast) [Pulsatilla pratensis] gb|AKM98418.1| photosystem II M protein (chloroplast) [Pulsatilla pratensis] gb|AKM98506.1| photosystem II M protein (chloroplast) [Pulsatilla vernalis] gb|AKM98594.1| photosystem II M protein (chloroplast) [Pulsatilla vernalis] gb|AKQ49257.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. altilis] gb|AKQ49344.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. altilis] gb|AKQ49431.1| photosystem II protein M (chloroplast) [Cynara baetica] gb|AKQ49518.1| photosystem II protein M (chloroplast) [Cynara cornigera] gb|AKQ49605.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49692.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49779.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49866.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49953.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ50040.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ50127.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50214.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50301.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50388.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50475.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50562.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50649.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50736.1| photosystem II protein M (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50823.1| photosystem II protein M (chloroplast) [Cynara syriaca] gb|AKQ51153.1| photosystem II protein M (plastid) [Borassus flabellifer] gb|AKR06841.1| photosystem II protein M (chloroplast) [Carnegiea gigantea] gb|AKR80586.1| photosystem II protein M (plastid) [Sararanga sinuosa] gb|AKR80709.1| photosystem II protein M (plastid) [Croomia japonica] gb|AKR80809.1| photosystem II protein M (plastid) [Xerophyta retinervis] gb|AKR80991.1| photosystem II protein M (plastid) [Stichoneuron caudatum] gb|AKR81062.1| photosystem II protein M (plastid) [Pentastemona sumatrana] gb|AKR81185.1| photosystem II protein M (plastid) [Freycinetia banksii] gb|AKR81222.1| photosystem II protein M (plastid) [Cyclanthus bipartitus] gb|AKS28765.1| photosystem II protein M (chloroplast) [Capsella rubella] gb|AKT93688.1| photosystem II protein M (chloroplast) [Rheum palmatum] gb|AKU47126.1| photosystem II protein M (chloroplast) [Ananas comosus] gb|AKU47244.1| photosystem II protein M (chloroplast) [Capsella grandiflora] gb|AKZ23246.1| photosystem II protein M (plastid) [Carduus nutans] gb|AKZ23247.1| photosystem II protein M (plastid) [Vernonia baldwinii] gb|AKZ23248.1| photosystem II protein M (plastid) [Helianthus pauciflorus subsp. subrhomboideus] gb|AKZ23249.1| photosystem II protein M (plastid) [Helianthus tuberosus] gb|AKZ23250.1| photosystem II protein M (plastid) [Rudbeckia hirta var. pulcherrima] gb|AKZ23251.1| photosystem II protein M (plastid) [Silphium integrifolium] gb|AKZ23252.1| photosystem II protein M (plastid) [Heliopsis helianthoides var. occidentalis] gb|AKZ23253.1| photosystem II protein M (plastid) [Grindelia squarrosa var. squarrosa] gb|AKZ23254.1| photosystem II protein M (plastid) [Solidago missouriensis] gb|AKZ23258.1| photosystem II protein M (plastid) [Symphoricarpos occidentalis] gb|AKZ23260.1| photosystem II protein M (plastid) [Physalis heterophylla] gb|AKZ23261.1| photosystem II protein M (plastid) [Physalis virginiana] gb|AKZ23262.1| photosystem II protein M (plastid) [Solanum carolinense] gb|AKZ23263.1| photosystem II protein M (plastid) [Solanum rostratum] gb|AKZ23264.1| photosystem II protein M (plastid) [Solanum triflorum] gb|AKZ23265.1| photosystem II protein M (plastid) [Monarda fistulosa var. mollis] gb|AKZ23266.1| photosystem II protein M (plastid) [Salvia nemorosa] gb|AKZ23267.1| photosystem II protein M (plastid) [Nepeta cataria] gb|AKZ23272.1| photosystem II protein M (plastid) [Verbena hastata] gb|AKZ23273.1| photosystem II protein M (plastid) [Veronica americana] gb|AKZ23275.1| photosystem II protein M (plastid) [Convolvulus arvensis] gb|AKZ23276.1| photosystem II protein M (plastid) [Ipomoea leptophylla] gb|AKZ23277.1| photosystem II protein M (plastid) [Evolvulus nuttallianus] gb|AKZ23281.1| photosystem II protein M (plastid) [Silene antirrhina] gb|AKZ23282.1| photosystem II protein M (plastid) [Silene vulgaris] gb|AKZ30106.1| photosystem II protein M (chloroplast) [Selliera radicans] gb|AKZ30165.1| photosystem II protein M (chloroplast) [Velleia rosea] gb|AKZ30231.1| photosystem II protein M (chloroplast) [Goodenia helmsii] gb|AKZ30363.1| photosystem II protein M (chloroplast) [Goodenia hassallii] gb|AKZ30429.1| photosystem II protein M (chloroplast) [Goodenia pinifolia] gb|AKZ30496.1| photosystem II protein M (chloroplast) [Goodenia viscida] gb|AKZ30562.1| photosystem II protein M (chloroplast) [Velleia discophora] gb|AKZ30628.1| photosystem II protein M (chloroplast) [Goodenia drummondii] gb|AKZ30694.1| photosystem II protein M (chloroplast) [Velleia foliosa] gb|AKZ30827.1| photosystem II protein M (chloroplast) [Goodenia tripartita] gb|AKZ30955.1| photosystem II protein M (chloroplast) [Goodenia filiformis] gb|AKZ31089.1| photosystem II protein M (chloroplast) [Goodenia decursiva] gb|AKZ31156.1| photosystem II protein M (chloroplast) [Scaevola collaris] gb|AKZ31214.1| photosystem II protein M (chloroplast) [Goodenia micrantha] gb|AKZ31350.1| photosystem II protein M (chloroplast) [Coopernookia polygalacea] gb|AKZ31416.1| photosystem II protein M (chloroplast) [Coopernookia strophiolata] gb|AKZ31480.1| photosystem II protein M (chloroplast) [Verreauxia reinwardtii] gb|AKZ31546.1| photosystem II protein M (chloroplast) [Goodenia phillipsiae] gb|ALB38577.1| photosystem II protein M (chloroplast) [Epipremnum aureum] gb|ALB78253.1| photosystem II protein M (chloroplast) [Tanaecium tetragonolobum] gb|ALD50097.1| PsbM (chloroplast) [Capsicum annuum var. glabriusculum] gb|ALD50183.1| PsbM (chloroplast) [Capsicum frutescens] gb|ALD50269.1| PsbM (chloroplast) [Capsicum annuum var. annuum] gb|ALD50355.1| PsbM (chloroplast) [Capsicum baccatum var. baccatum] gb|ALE28961.1| photosystem II protein M (plastid) [Colpothrinax cookii] gb|ALF35924.1| photosystem II protein M (chloroplast) [Oryza sativa aromatic subgroup] gb|ALF36001.1| photosystem II protein M (chloroplast) [Oryza sativa tropical japonica subgroup] gb|ALF99697.1| photosystem II protein M (chloroplast) [Colobanthus quitensis] gb|ALI31134.1| photosystem II protein M (chloroplast) [Solanum nigrum] gb|ALI91923.1| PsbM (chloroplast) [Apodytes dimidiata] gb|ALI91925.1| PsbM (chloroplast) [Cassinopsis madagascariensis] gb|ALI91926.1| PsbM (chloroplast) [Cordia sebestena] gb|ALI91928.1| PsbM (chloroplast) [Discophora guianensis] gb|ALI91929.1| PsbM (chloroplast) [Emmotum nitens] gb|ALI91930.1| PsbM (chloroplast) [Garrya flavescens] gb|ALI91932.1| PsbM (chloroplast) [Hydrolea corymbosa] gb|ALI91943.1| PsbM (chloroplast) [Oncotheca balansae] gb|ALI91945.1| PsbM (chloroplast) [Platea latifolia] gb|ALI91946.1| PsbM (chloroplast) [Polypremum procumbens] gb|ALI91955.1| PsbM (chloroplast) [Sphenoclea zeylanica] gb|ALI91957.1| PsbM (chloroplast) [Vahlia capensis] gb|ALJ49590.1| photosystem II protein M (chloroplast) [Pseudosasa japonica] gb|ALJ49667.1| photosystem II protein M (chloroplast) [Pseudosasa japonica] gb|ALJ78244.1| photosystem II protein M (plastid) [Plantago maritima] gb|ALJ78340.1| photosystem II protein M (plastid) [Plantago media] gb|ALK00672.1| PsbM (chloroplast) [Oryza glumipatula] gb|ALK00777.1| PsbM (chloroplast) [Oryza glumipatula] gb|ALK26610.1| photosystem II protein M (chloroplast) [Ostrya rehderiana] gb|ALL53067.1| photosystem II protein M (chloroplast) [Bletilla striata] gb|ALL97035.1| photosystem II protein M (chloroplast) [Musa balbisiana] gb|ALN11567.1| photosystem II protein M (chloroplast) [Iochroma edule] gb|ALN11597.1| photosystem II protein M (chloroplast) [Scutellaria insignis] gb|ALN98165.1| photosystem II protein M (chloroplast) [Dendrobium chrysotoxum] gb|ALP83540.1| photosystem II protein M (chloroplast) [Curcuma flaviflora] gb|ALS20006.1| photosystem II protein M (chloroplast) [Metanarthecium luteoviride] gb|ALT06370.1| photosystem II protein M (chloroplast) [Guadua chacoensis] gb|ALT06454.1| photosystem II protein M (chloroplast) [Merostachys sp. Greco 18] gb|ALT14466.1| photosystem II protein M (chloroplast) [Nicotiana otophora] gb|ALT55444.1| photosystem II protein M (chloroplast) [Syagrus coronata] gb|ALV25562.1| photosystem II protein M (chloroplast) [Aletris spicata] gb|ALV25646.1| photosystem II protein M (chloroplast) [Aletris fauriei] emb|CUA65568.1| photosystem II protein M (chloroplast) [Capsella rubella] emb|CUA65652.1| photosystem II protein M (chloroplast) [Camelina sativa] gb|ALV90222.1| photosystem II protein M (chloroplast) [Silene latifolia subsp. alba] gb|ALV90303.1| photosystem II protein M (chloroplast) [Silene latifolia subsp. alba] gb|ALZ50011.1| PSII M protein (chloroplast) [Abeliophyllum distichum] gb|ALZ50098.1| PSII low MW protein M (chloroplast) [Coreanomecon hylomeconoides] gb|AMB20966.1| photosystem II protein M (chloroplast) [Oryza minuta] gb|AMC31872.1| photosystem II protein M (chloroplast) [Capsella bursa-pastoris] gb|AMC31883.1| photosystem II protein M (chloroplast) [Lepidium densiflorum] gb|AMC31887.1| photosystem II protein M (chloroplast) [Oxalis dillenii] gb|AMC31889.1| photosystem II protein M (chloroplast) [Physaria ludoviciana] gb|AMD07888.1| photosystem II protein M (chloroplast) [Diospyros kaki] gb|AMD08098.1| photosystem II protein M (chloroplast) [Akebia trifoliata] gb|AMD08267.1| photosystem II protein M (chloroplast) [Euptelea pleiosperma] gb|AMD08352.1| photosystem II protein M (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|AMD08521.1| photosystem II protein M (chloroplast) [Stephania japonica] gb|AMD08606.1| photosystem II protein M (chloroplast) [Pachysandra terminalis] gb|AMH85868.1| photosystem II protein M (chloroplast) [Quercus baronii] gb|AMK97312.1| psbM (chloroplast) [Drosera rotundifolia] gb|AML26895.1| photosystem II protein M (chloroplast) [Monsonia emarginata] gb|AMM05537.1| photosystem II protein M (plastid) [Nicotiana tabacum] gb|AMN14339.1| photosystem II protein M (chloroplast) [Utricularia reniformis] gb|AMP19570.1| photosystem II protein M (chloroplast) [Iochroma cardenasianum] gb|AMQ13314.1| photosystem II protein M (plastid) [Tofieldia thibetica] gb|AMQ13399.1| photosystem II protein M (plastid) [Potamogeton perfoliatus] gb|AMQ13484.1| photosystem II protein M (plastid) [Sagittaria lichuanensis] gb|AMQ32854.1| photosystem II protein M (chloroplast) [Stenogyne haliakalae] gb|AMQ32942.1| photosystem II protein M (chloroplast) [Phyllostegia waimeae] gb|AMQ33030.1| photosystem II protein M (chloroplast) [Stenogyne bifida] gb|AMQ33118.1| photosystem II protein M (chloroplast) [Haplostachys haplostachya] gb|AMQ33206.1| photosystem II protein M (chloroplast) [Phyllostegia velutina] gb|AMQ33382.1| photosystem II protein M (chloroplast) [Stenogyne kanehoana] gb|AMQ33470.1| photosystem II protein M (chloroplast) [Haplostachys linearifolia] gb|AMQ33558.1| photosystem II protein M (chloroplast) [Stachys chamissonis] gb|AMQ33646.1| photosystem II protein M (chloroplast) [Stachys coccinea] gb|AMQ33734.1| photosystem II protein M (chloroplast) [Stachys sylvatica] gb|AMQ33822.1| photosystem II protein M (chloroplast) [Stachys byzantina] gb|AMQ33923.1| photosystem II protein M (chloroplast) [Helianthus petiolaris subsp. fallax] gb|AMQ99368.1| photosystem II M protein (chloroplast) [Aconitum chiisanense] gb|AMR00384.1| photosystem II protein M (chloroplast) [Iochroma australe] gb|AMR73816.1| photosystem II M protein (chloroplast) [Kolkwitzia amabilis] gb|AMR74102.1| PsbM (chloroplast) [Perilla frutescens] gb|AMR74190.1| PsbM (chloroplast) [Perilla frutescens var. acuta] gb|AMR74278.1| PsbM (chloroplast) [Perilla frutescens f. crispidiscolor] gb|AMR74366.1| PsbM (chloroplast) [Perilla frutescens var. crispa] gb|AMR74454.1| PsbM (chloroplast) [Perilla frutescens var. crispa] gb|AMR74542.1| PsbM (chloroplast) [Perilla frutescens var. frutescens] gb|AMR74630.1| PsbM (chloroplast) [Perilla citriodora] gb|AMR74718.1| PsbM (chloroplast) [Perilla frutescens var. hirtella] gb|AMR74806.1| PsbM (chloroplast) [Perilla setoyensis] gb|AMV74052.1| photosystem II protein M (plastid) [Iochroma lehmannii] gb|AMW65026.1| photosystem II protein M (chloroplast) [Mauritia flexuosa] gb|AMW65112.1| photosystem II protein M (plastid) [Caryota mitis] gb|AMW65198.1| photosystem II protein M (plastid) [Wallichia densiflora] gb|AMW65283.1| photosystem II protein M (plastid) [Veitchia arecina] gb|AMW65369.1| photosystem II protein M (plastid) [Trithrinax brasiliensis] gb|AMW65456.1| photosystem II protein M (plastid) [Tahina spectabilis] gb|AMW65535.1| photosystem II protein M (plastid) [Serenoa repens] gb|AMW65707.1| photosystem II protein M (plastid) [Pritchardia thurstonii] gb|AMW65793.1| photosystem II protein M (plastid) [Pigafetta elata] gb|AMW65880.1| photosystem II protein M (plastid) [Phytelephas aequatorialis] gb|AMW65966.1| photosystem II protein M (plastid) [Nypa fruticans] gb|AMW66052.1| photosystem II protein M (plastid) [Metroxylon warburgii] gb|AMW66138.1| photosystem II protein M (plastid) [Lodoicea maldivica] gb|AMW66224.1| photosystem II protein M (plastid) [Licuala paludosa] gb|AMW66310.1| photosystem II protein M (plastid) [Leucothrinax morrisii] gb|AMW66396.1| photosystem II protein M (plastid) [Hanguana malayana] gb|AMW66482.1| photosystem II protein M (plastid) [Eugeissona tristis] gb|AMW66564.1| photosystem II protein M (plastid) [Eremospatha macrocarpa] gb|AMW66650.1| photosystem II protein M (plastid) [Corypha lecomtei] gb|AMW66736.1| photosystem II protein M (plastid) [Chuniophoenix nana] gb|AMW66822.1| photosystem II protein M (plastid) [Chamaerops humilis] gb|AMW66908.1| photosystem II protein M (plastid) [Brahea brandegeei] gb|AMW66994.1| photosystem II protein M (plastid) [Borassodendron machadonis] gb|AMW67080.1| photosystem II protein M (plastid) [Baxteria australis] gb|AMW67166.1| photosystem II protein M (plastid) [Arenga caudata] gb|AMW67252.1| photosystem II protein M (plastid) [Areca vestiaria] gb|AMW67331.1| photosystem II protein M (plastid) [Acoelorraphe wrightii] gb|AMW67417.1| photosystem II protein M (plastid) [Washingtonia robusta] gb|AMX21457.1| photosystem II protein M (chloroplast) [Helianthus praecox] gb|AMX21591.1| photosystem II protein M (chloroplast) [Iochroma grandiflorum] gb|AMX21682.1| photosystem II protein M (chloroplast) [Iochroma parvifolium] gb|AMX22330.1| photosystem II protein M (chloroplast) [Helianthus petiolaris] gb|AMX23152.1| photosystem II protein M (chloroplast) [Solanum melongena] gb|AMX23231.1| photosystem II protein M (plastid) [Ananas comosus] gb|AMY95752.1| photosystem II protein M (chloroplast) [Iochroma umbellatum] gb|AMY95987.1| photosystem II protein M (plastid) [Geranium incanum] gb|ANA07551.1| photosystem II protein M (chloroplast) [Acnistus arborescens x Iochroma cyaneum] gb|ANA10808.1| photosystem II protein M (chloroplast) [Cabomba caroliniana] gb|ANA56572.1| photosystem II protein M (plastid) [Annona cherimola] gb|ANA56680.1| photosystem II protein M (chloroplast) [Iochroma lehmannii] gb|ANA56795.1| photosystem II protein M (chloroplast) [Iochroma salpoanum] gb|ANA57528.1| photosystem II protein M (plastid) [Veronica nakaiana] gb|ANA57616.1| photosystem II protein M (plastid) [Veronica persica] gb|ANA57702.1| photosystem II protein M (plastid) [Veronicastrum sibiricum] gb|ANA91059.1| photosystem II protein M (chloroplast) [Eriolarynx fasciculata] gb|ANA91194.1| photosystem II protein M (chloroplast) [Helianthus debilis] gb|ANB44477.1| photosystem II protein M (chloroplast) [Iochroma ellipticum] gb|ANB44561.1| photosystem II protein M (chloroplast) [Iochroma cyaneum] gb|ANB78716.1| photosystem II protein M (chloroplast) [Bruinsmia polysperma] gb|ANB78980.1| photosystem II protein M (chloroplast) [Helianthus annuus subsp. texanus] gb|ANC49166.1| photosystem II protein M (chloroplast) [Acnistus arborescens] gb|ANC62757.1| PsbM (plastid) [Solanum melongena] gb|ANC62909.1| photosystem II protein M (chloroplast) [Erythranthe lutea] gb|ANC95050.1| photosystem II protein M (chloroplast) [Dunalia spathulata] gb|ANC95229.1| photosystem II protein M (plastid) [Iochroma gesnerioides] gb|ANC95361.1| photosystem II protein M (chloroplast) [Iochroma cyaneum] gb|ANC96372.1| photosystem II protein M (chloroplast) [Iochroma albianthum] gb|AND96964.1| PSII M protein (chloroplast) [Cornus controversa] gb|ANE11136.1| photosystem II protein M (plastid) [Ananas comosus] gb|ANE20275.1| photosystem II protein M (plastid) [Iochroma confertiflorum] gb|ANF03653.1| photosystem II protein M (chloroplast) [Helianthus argophyllus] gb|ANF03885.1| photosystem II protein M (plastid) [Helianthus annuus] gb|ANF05207.1| photosystem II protein M (chloroplast) [Scopolia parviflora] gb|ANG07764.1| PSII low MW protein M (chloroplast) [Neofinetia falcata] gb|ANG07838.1| PSII low MW protein M (chloroplast) [Neofinetia richardsiana] gb|ANG07912.1| PSII low MW protein M (chloroplast) [Neofinetia falcata] gb|ANG08098.1| photosystem II protein M (chloroplast) [Lychnis wilfordii] gb|ANG08181.1| photosystem II protein M (chloroplast) [Silene capitata] gb|ANG44664.1| photosystem II protein M (chloroplast) [Oryza sativa Indica Group] emb|CZF94795.1| PSII low MW protein (chloroplast) [Arabidopsis suecica] emb|CZF94880.1| PSII low MW protein (chloroplast) [Arabidopsis suecica] emb|CZF94965.1| PSII low MW protein (chloroplast) [Arabidopsis suecica] gb|ANJ03951.1| PsbM (chloroplast) [Capsicum chinense] gb|ANJ04267.1| photosystem II protein M (plastid) [Castilleja paramensis] gb|ANJ04384.1| photosystem II M protein (chloroplast) [Aconitum kusnezoffii] gb|ANJ04467.1| photosystem II M protein (chloroplast) [Gymnaconitum gymnandrum] gb|ANJ04550.1| photosystem II M protein (chloroplast) [Aconitum barbatum var. puberulum] gb|ANJ59888.1| photosystem II protein M (chloroplast) [Nymphaea jamesoniana] gb|ANJ78498.1| photosystem II protein M (chloroplast) [Oryza brachyantha] gb|ANN44724.1| photosystem II protein M (chloroplast) [Liriodendron chinense] gb|ANO44348.1| photosystem II protein M (chloroplast) [Nymphaea ampla] gb|ANO44529.1| photosystem II protein M (chloroplast) [Alstroemeria longistaminea] gb|ANO44652.1| photosystem II protein M (chloroplast) [Bomarea sp. 878] gb|ANO44835.1| photosystem II protein M (chloroplast) [Philesia magellanica] gb|ANO44957.1| photosystem II protein M (chloroplast) [Uvularia grandiflora] gb|ANO45016.1| photosystem II protein M (chloroplast) [Uvularia sessiliflora] gb|ANO45075.1| photosystem II protein M (chloroplast) [Wurmbea pygmaea] gb|ANO45243.1| photosystem II protein M (chloroplast) [Lapageria rosea] gb|ANO45482.1| photosystem II protein M (chloroplast) [Burchardia umbellata] gb|ANO45542.1| photosystem II protein M (chloroplast) [Ripogonum album] gb|ANO45603.1| photosystem II protein M (chloroplast) [Prosartes lanuginosa] gb|ANO45664.1| photosystem II protein M (chloroplast) [Petermannia cirrosa] gb|ANP25490.1| PSII M protein (chloroplast) [Eucommia ulmoides] gb|ANP25595.1| photosystem II protein M (chloroplast) [Schisandra chinensis] gb|ANP25679.1| photosystem II protein M (chloroplast) [Quercus edithiae] gb|ANP26012.1| PSII M protein (chloroplast) [Hypolytrum nemorum] gb|ANQ38731.1| photosystem II protein M (plastid) [Bergbambos tessellata] gb|ANQ38813.1| photosystem II protein M (plastid) [Fargesia nitida] gb|ANQ39007.1| photosystem II protein M (plastid) [Oldeania alpina] gb|ANQ39091.1| photosystem II protein M (plastid) [Phyllostachys aurea] gb|ANQ39219.1| photosystem II protein M (plastid) [Sasa veitchii] gb|ANQ46319.1| psbM (chloroplast) [Pogostemon cablin] gb|ANS11078.1| photosystem II protein M (plastid) [Chimonocalamus sp. Clark & Reiners s.n.] gb|ANS11161.1| photosystem II protein M (plastid) [Shibataea kumasaca] gb|ANS57509.1| photosystem II protein M (chloroplast) [Nymphaea alba] gb|ANS71675.1| PSII M protein (chloroplast) [Carex neurocarpa] gb|ANS80720.1| photosystem II protein M (chloroplast) [Ilex latifolia] gb|ANS80815.1| photosystem II protein M (chloroplast) [Ilex szechwanensis] gb|ANS80910.1| photosystem II protein M (chloroplast) [Ilex pubescens] gb|ANS81005.1| photosystem II protein M (chloroplast) [Ilex polyneura] gb|ANS81100.1| photosystem II protein M (chloroplast) [Ilex sp. XY-2016] gb|ANS81195.1| photosystem II protein M (chloroplast) [Ilex delavayi] gb|ANS81290.1| photosystem II protein M (chloroplast) [Ilex wilsonii] gb|ANT72464.1| photosystem II protein M (chloroplast) [Cephalanthera longifolia] gb|ANT72552.1| photosystem II protein M (chloroplast) [Epipactis mairei] gb|ANT72747.1| photosystem II protein M (chloroplast) [Epipactis veratrifolia] gb|ANT72863.1| photosystem II protein M (chloroplast) [Neottia pinetorum] gb|ANT72948.1| photosystem II protein M (chloroplast) [Listera fugongensis] gb|ANT73034.1| photosystem II protein M (chloroplast) [Neottia ovata] gb|ANU80148.1| PSII low MW protein M (chloroplast) [Averrhoa carambola] gb|ANU80297.1| photosystem II M protein (chloroplast) [Aconitum carmichaelii] gb|ANV27748.1| PsbM (chloroplast) [Aconitum coreanum] gb|ANW06554.1| photosystem II protein M (chloroplast) [Ampelocalamus naibunensis] gb|ANW36487.1| photosystem II protein M (chloroplast) [Quercus aliena] gb|ANW36573.1| photosystem II protein M (chloroplast) [Quercus aliena var. acutiserrata] gb|ANW36659.1| photosystem II protein M (chloroplast) [Quercus variabilis] gb|ANW36745.1| photosystem II protein M (chloroplast) [Quercus dolicholepis] gb|ANW36902.1| photosystem II protein M (chloroplast) [Amaranthus hypochondriacus] gb|ANW47784.1| photosystem II protein M (chloroplast) [Arabidopsis thaliana] gb|ANW47949.1| PsbM (chloroplast) [Eclipta prostrata] gb|ANX10378.1| photosystem II protein M (plastid) [Kuruna densifolia] gb|ANY59800.1| PsbM (chloroplast) [Aconitum volubile] gb|ANY60334.1| photosystem II protein M (chloroplast) [Averrhoa carambola] gb|ANZ53268.1| PSII low MW protein M (chloroplast) [Carissa macrocarpa] dbj|BAV56628.1| photosystem II protein M (chloroplast) [Ipomoea nil] gb|AON77181.1| photosystem II protein M (chloroplast) [Actinidia polygama] gb|AON77264.1| photosystem II protein M (chloroplast) [Actinidia tetramera] gb|AON77281.1| photosystem II protein M (chloroplast) [Clematoclethra scandens subsp. hemsleyi] gb|AOP19380.1| photosystem II protein M (chloroplast) [Helwingia himalaica] gb|AOQ76916.1| photosystem II protein M (chloroplast) [Davidia involucrata] gb|AOR40733.1| photosystem II protein M (chloroplast) [Streptochaeta spicata] gb|AOR40816.1| photosystem II protein M (chloroplast) [Leptaspis banksii] gb|AOR40891.1| photosystem II protein M (chloroplast) [Leptaspis zeylanica] gb|AOS52953.1| photosystem II M protein (chloroplast) [Aconitum austrokoreense] gb|AOS85817.1| photosystem II proteinM (chloroplast) [Aconitum barbatum var. hispidum] gb|AOS85902.1| photosystem II proteinM (chloroplast) [Aconitum ciliare] gb|AOS85988.1| photosystem II proteinM (chloroplast) [Aconitum coreanum] gb|AOS86073.1| photosystem II proteinM (chloroplast) [Aconitum jaluense subsp. jaluense] gb|AOS86158.1| photosystem II proteinM (chloroplast) [Aconitum jaluense subsp. jaluense] gb|AOS86243.1| photosystem II proteinM (chloroplast) [Aconitum japonicum subsp. napiforme] gb|AOS86328.1| photosystem II proteinM (chloroplast) [Aconitum kusnezoffii] gb|AOS86413.1| photosystem II proteinM (chloroplast) [Aconitum monanthum] gb|AOS86739.1| photosystem II protein M (chloroplast) [Joinvillea ascendens] gb|AOV63471.1| PsbM (chloroplast) [Avena sterilis] gb|AOV63576.1| photosystem II protein M (chloroplast) [Ranunculus occidentalis] gb|AOW32199.1| photosystem II M protein (chloroplast) [Mentha longifolia] gb|AOW68888.1| photosystem II protein M (chloroplast) [Ranunculus austro-oreganus] gb|AOX12913.1| photosystem II protein M (chloroplast) [Cocos nucifera] gb|AOX13123.1| photosystem II protein M (chloroplast) [Fagopyrum tataricum] gb|AOX22859.1| photosystem II protein M (chloroplast) [Mikania micrantha] gb|AOY40696.1| photosystem II protein M (chloroplast) [Trollius chinensis] gb|AOY41521.1| photosystem II protein M (chloroplast) [Haberlea rhodopensis] gb|AOY41698.1| photosystem II protein M (chloroplast) [Galinsoga quadriradiata] gb|APA17499.1| photosystem II protein M (chloroplast) [Dracocephalum palmatum] gb|APA19113.1| photosystem II protein M (plastid) [Alniphyllum eberhardtii] gb|APB91773.1| photosystem II protein M (chloroplast) [Victoria cruziana] gb|APD83324.1| photosystem II protein M (chloroplast) [Carthamus tinctorius] gb|APH08476.1| photosystem II protein M (chloroplast) [Amaranthus tricolor] gb|APO11209.1| photosystem II protein M (chloroplast) [Albuca kirkii] gb|APO15241.1| photosystem II protein M (chloroplast) [Cistanthe longiscapa] gb|APS85500.1| PSII low MW protein M (chloroplast) [Pouteria campechiana] gb|APS85585.1| PSII low MW protein M (chloroplast) [Diospyros blancoi] gb|APS87140.1| photosystem II protein M (chloroplast) [Carpinus putoensis] gb|APT41629.1| PsbM (chloroplast) [Capsicum galapagoense] gb|APT41716.1| PsbM (chloroplast) [Capsicum chinense] gb|APT41803.1| PsbM (chloroplast) [Capsicum chacoense] gb|APT41890.1| PsbM (chloroplast) [Capsicum tovarii] gb|APT41977.1| PsbM (chloroplast) [Capsicum eximium] gb|APT42314.1| PSII M protein (chloroplast) [Rehmannia chingii] gb|APU52702.1| photosystem II protein M (chloroplast) [Castanea henryi] gb|APY18817.1| photosystem II protein M (chloroplast) [Akebia quinata] gb|APZ75461.1| photosystem II reaction center M protein (chloroplast) [Saussurea chabyoungsanica] gb|APZ83133.1| photosystem II protein M (chloroplast) [Symplocarpus renifolius] gb|AQM37955.1| photosystem II protein M (chloroplast) [Betula nana] gb|AQM51584.1| photosystem II protein M (chloroplast) [Quercus aquifolioides] gb|AQM51670.1| photosystem II protein M (chloroplast) [Quercus spinosa] gb|AQS79778.1| photosystem II protein M (chloroplast) [Utricularia foliosa] gb|AQU12886.1| PSII M protein (chloroplast) [Camellia huana] gb|AQU12973.1| PSII M protein (chloroplast) [Camellia liberofilamenta] gb|AQU13060.1| PSII M protein (chloroplast) [Camellia luteoflora] gb|AQU14220.1| photosystem II protein M (chloroplast) [Leersia perrieri] gb|AQU64718.1| photosystem II protein M (chloroplast) [Camptotheca acuminata] gb|AQU64803.1| photosystem II protein M (chloroplast) [Davidia involucrata] gb|AQU64890.1| photosystem II protein M (chloroplast) [Nyssa sinensis] gb|AQV10534.1| photosystem II protein M (chloroplast) [Camelina sativa] gb|AQV10596.1| PSII low MW protein (chloroplast) [Lepidium meyenii] gb|AQV10706.1| photosystem II protein M (chloroplast) [Tarenaya hassleriana] gb|AQV11189.1| photosystem II protein M (chloroplast) [Tillandsia usneoides] gb|AQW41572.1| photosystem II protein M (chloroplast) [Fagus engleriana] gb|AQW41660.1| photosystem II protein M (chloroplast) [Quercus glauca] gb|AQX33518.1| photosystem II protein M (chloroplast) [Pityopsis falcata] gb|AQY15691.1| photosystem II protein M (chloroplast) [Ostrya trichocarpa] gb|AQY55949.1| PsbM (chloroplast) [Aconitum austrokoreense] gb|AQY56035.1| PsbM (chloroplast) [Aconitum carmichaelii] gb|AQY56122.1| PsbM (chloroplast) [Aconitum longecassidatum] gb|AQY56209.1| PsbM (chloroplast) [Aconitum pseudolaeve] gb|AQZ40555.1| PSII M protein (chloroplast) [Rehmannia glutinosa] gb|AQZ40642.1| PSII M protein (chloroplast) [Rehmannia henryi] gb|AQZ40730.1| PSII M protein (chloroplast) [Rehmannia solanifolia] gb|AQZ40817.1| PSII M protein (chloroplast) [Rehmannia piasezkii] gb|AQZ40904.1| PSII M protein (chloroplast) [Rehmannia elata] gb|ARB02605.1| photosystem II protein M (chloroplast) [Schisandra sphenanthera] gb|ARB02776.1| photosystem II protein M (plastid) [Echinacea paradoxa] gb|ARB02861.1| photosystem II protein M (plastid) [Echinacea pallida] gb|ARB02946.1| photosystem II protein M (plastid) [Echinacea laevigata] gb|ARB03031.1| photosystem II protein M (plastid) [Echinacea atrorubens] gb|ARB03116.1| photosystem II protein M (plastid) [Echinacea angustifolia] gb|ARB03201.1| photosystem II protein M (plastid) [Echinacea speciosa] gb|ARB03286.1| photosystem II protein M (plastid) [Echinacea tennesseensis] gb|ARB03371.1| photosystem II protein M (plastid) [Echinacea purpurea] gb|ARB03456.1| photosystem II protein M (plastid) [Echinacea sanguinea] gb|ARF05972.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus] gb|ARH02852.1| PsbM (chloroplast) [Diplostephium alveolatum] gb|ARH03107.1| PsbM (chloroplast) [Archibaccharis asperifolia] gb|ARH03277.1| PsbM (chloroplast) [Oritrophium peruvianum] gb|ARH03532.1| PsbM (chloroplast) [Baccharis genistelloides] gb|ARH03956.1| PsbM (chloroplast) [Heterothalamus alienus] gb|ARH04126.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH04296.1| PsbM (chloroplast) [Laestadia muscicola] gb|ARH04381.1| PsbM (chloroplast) [Diplostephium rhomboidale] gb|ARH04466.1| PsbM (chloroplast) [Diplostephium tenuifolium] gb|ARH04551.1| PsbM (chloroplast) [Diplostephium colombianum] gb|ARH04721.1| PsbM (chloroplast) [Diplostephium revolutum] gb|ARH04976.1| PsbM (chloroplast) [Exostigma notobellidiastrum] gb|ARH05061.1| PsbM (chloroplast) [Diplostephium rupestre] gb|ARH05316.1| PsbM (chloroplast) [Diplostephium rhododendroides] gb|ARH05401.1| PsbM (chloroplast) [Blakiella bartsiifolia] gb|ARH05571.1| PsbM (chloroplast) [Baccharis tricuneata] gb|ARH05656.1| PsbM (chloroplast) [Diplostephium cinereum] gb|ARH05741.1| PsbM (chloroplast) [Diplostephium rhomboidale] gb|ARH05826.1| PsbM (chloroplast) [Diplostephium violaceum] gb|ARH06251.1| PsbM (chloroplast) [Diplostephium eriophorum] gb|ARH06336.1| PsbM (chloroplast) [Diplostephium glutinosum] gb|ARH06421.1| PsbM (chloroplast) [Diplostephium antioquense] gb|ARH06506.1| PsbM (chloroplast) [Laennecia sophiifolia] gb|ARH06676.1| PsbM (chloroplast) [Diplostephium costaricense] gb|ARH07016.1| PsbM (chloroplast) [Diplostephium crypteriophyllum] gb|ARH07101.1| PsbM (chloroplast) [Diplostephium oblongifolium] gb|ARH07271.1| PsbM (chloroplast) [Llerasia caucana] gb|ARH07441.1| PsbM (chloroplast) [Hinterhubera ericoides] gb|ARH07526.1| PsbM (chloroplast) [Diplostephium romeroi] gb|ARH07696.1| PsbM (chloroplast) [Diplostephium juajibioyi] gb|ARH07781.1| PsbM (chloroplast) [Diplostephium venezuelense] gb|ARH07866.1| PsbM (chloroplast) [Diplostephium huertasii] gb|ARH08206.1| PsbM (chloroplast) [Diplostephium meyenii] gb|ARH08291.1| PsbM (chloroplast) [Diplostephium obtusum] gb|ARH08376.1| PsbM (chloroplast) [Westoniella kohkemperi] gb|ARH08461.1| PsbM (chloroplast) [Diplostephium tachirense] gb|ARH08546.1| PsbM (chloroplast) [Parastrephia quadrangularis] gb|ARH08631.1| PsbM (chloroplast) [Diplostephium serratifolium] gb|ARH08801.1| PsbM (chloroplast) [Diplostephium schultzii] gb|ARH08886.1| PsbM (chloroplast) [Diplostephium frontinense] gb|ARH08971.1| PsbM (chloroplast) [Diplostephium jaramilloi] gb|ARH09056.1| PsbM (chloroplast) [Diplostephium mutiscuanum] gb|ARH09141.1| PsbM (chloroplast) [Diplostephium inesianum] gb|ARH09226.1| PsbM (chloroplast) [Diplostephium heterophyllum] gb|ARH09396.1| PsbM (chloroplast) [Diplostephium camargoanum] gb|ARH09481.1| PsbM (chloroplast) [Diplostephium jenesanum] gb|ARH09565.1| PsbM (chloroplast) [Aztecaster matudae] gb|ARH09650.1| PsbM (chloroplast) [Diplostephium schultzii] gb|ARH09735.1| PsbM (chloroplast) [Diplostephium coriaceum] gb|ARH09905.1| PsbM (chloroplast) [Diplostephium rosmarinifolium] gb|ARH10245.1| PsbM (chloroplast) [Diplostephium apiculatum] gb|ARH10415.1| PsbM (chloroplast) [Diplostephium ochraceum] gb|ARH53474.1| photosystem II protein M (chloroplast) [Schisandra chinensis] gb|ARI43524.1| photosystem II protein M (chloroplast) [Actinidia arguta] gb|ARI43608.1| photosystem II protein M (chloroplast) [Actinidia eriantha] gb|ARI43692.1| photosystem II protein M (chloroplast) [Actinidia kolomikta] gb|ARI44169.1| photosystem II protein M (chloroplast) [Lepidium meyenii] gb|ARI49838.1| photosystem II protein M (plastid) [Ipomoea trifida] gb|ARJ60987.1| photosystem II protein M (plastid) [Illicium floridanum] gb|ARJ61071.1| photosystem II protein M (plastid) [Dioscorea villosa] gb|ARJ61154.1| PsbM (plastid) [Magnolia biondii] gb|ARJ61239.1| photosystem II protein M (plastid) [Digitalis lanata] gb|ARJ61319.1| photosystem II protein M (plastid) [Illicium verum] gb|ARJ61495.1| photosystem II protein M (plastid) [Jasminum tortuosum] gb|ARJ61665.1| photosystem II M protein (plastid) [Scutellaria lateriflora] gb|ARJ61837.1| photosystem II protein M (plastid) [Jasminum sambac] gb|ARJ62511.1| photosystem II protein M (plastid) [Illicium henryi] gb|ARJ63018.1| PsbM (plastid) [Magnolia officinalis] gb|ARJ63102.1| PsbM (plastid) [Magnolia denudata] gb|ARJ63186.1| photosystem II protein M (plastid) [Hydrastis canadensis] gb|ARJ63266.1| photosystem II protein M (plastid) [Illicium anisatum] gb|ARO91679.1| photosystem II protein M (chloroplast) [Streptogyna americana] gb|ARQ27654.1| photosystem II protein M (chloroplast) [Humbertochloa bambusiuscula] gb|ARQ28240.1| PsbM (chloroplast) [Phyllorachis sagittata] gb|ARQ28411.1| photosystem II protein M (chloroplast) [Rhipidocladum pittieri] gb|ARQ81361.1| photosystem II M protein (chloroplast) [Aconitum carmichaelii] gb|ARR27819.1| photosystem II protein M (chloroplast) [Aster altaicus] gb|ARS00927.1| PsbM (chloroplast) [Chenopodium quinoa] gb|ARS01011.1| PsbM (chloroplast) [Chenopodium album] gb|ARS01095.1| PsbM (chloroplast) [Solanum berthaultii] gb|ARS43895.1| photosystem II protein M (chloroplast) [Chionanthus retusus] gb|ARS44173.1| photosystem II protein M (chloroplast) [Morella rubra] gb|ARS44256.1| photosystem II protein M (chloroplast) [Morella rubra] gb|ARS44339.1| photosystem II protein M (chloroplast) [Morella rubra] gb|ARU77235.1| photosystem II protein M (chloroplast) [Ocimum basilicum] gb|ARV86662.1| photosystem II M protein (chloroplast) [Salvia japonica] gb|ARV87350.1| photosystem II protein M (chloroplast) [Chenopodium quinoa] dbj|BAX89000.1| photosystem II protein M (chloroplast) [Dendrobium salaccense] gb|ARX79234.1| photosystem II protein M (chloroplast) [Camptotheca acuminata] gb|ARX79316.1| photosystem II protein M (chloroplast) [Decaisnea insignis] gb|ASA46270.1| photosystem II protein M (chloroplast) [Aldrovanda vesiculosa] gb|ASA46350.1| photosystem II protein M (chloroplast) [Dionaea muscipula] gb|ASA46577.1| photosystem II protein M (chloroplast) [Sinojackia xylocarpa] gb|ASB29525.1| photosystem II protein M (chloroplast) [Barclaya longifolia] gb|ASB29998.1| photosystem II protein M (chloroplast) [Carpinus cordata] gb|ASD34247.1| photosystem II protein M (chloroplast) [Castanea mollissima] gb|ASD34330.1| photosystem II protein M (chloroplast) [Actinidia kolomikta] gb|ASF62410.1| photosystem II protein M (chloroplast) [Magnolia alba] gb|ASK06628.1| photosystem II protein M (plastid) [Schima argentea] gb|ASK06715.1| photosystem II protein M (plastid) [Schima brevipedicellata] gb|ASK06802.1| photosystem II protein M (plastid) [Schima crenata] gb|ASK06889.1| photosystem II protein M (plastid) [Schima khasiana] gb|ASK06976.1| photosystem II protein M (plastid) [Schima multibracteata] gb|ASK07063.1| photosystem II protein M (plastid) [Schima noronhae] gb|ASK07150.1| photosystem II protein M (plastid) [Schima remotiserrata] gb|ASK07237.1| photosystem II protein M (plastid) [Schima sericans] gb|ASK07324.1| photosystem II protein M (plastid) [Schima sinensis] gb|ASK07411.1| photosystem II protein M (plastid) [Schima superba] gb|ASK07498.1| photosystem II protein M (plastid) [Schima wallichii] gb|ASL06280.1| photosystem II protein M (chloroplast) [Zantedeschia aethiopica] gb|ASL69858.1| photosystem II protein M (chloroplast) [Musella lasiocarpa] gb|ASM42132.1| photosystem II protein M (plastid) [Pyrenaria menglaensis] gb|ASM42152.1| photosystem II protein M (plastid) [Stewartia sinensis] gb|ASM42306.1| photosystem II protein M (plastid) [Camellia oleifera] gb|ASM42393.1| photosystem II protein M (plastid) [Apterosperma oblata] gb|ASM42480.1| photosystem II protein M (plastid) [Pyrenaria pingpienensis] gb|ASM42567.1| photosystem II protein M (plastid) [Pyrenaria spectabilis var. greeniae] gb|ASM42654.1| photosystem II protein M (plastid) [Polyspora speciosa] gb|ASM42741.1| photosystem II protein M (plastid) [Pyrenaria khasiana] gb|ASM42828.1| photosystem II protein M (plastid) [Pyrenaria spectabilis var. greeniae] gb|ASM42915.1| photosystem II protein M (plastid) [Camellia tachangensis var. remotiserrata] gb|ASM43002.1| photosystem II protein M (plastid) [Polyspora axillaris] gb|ASM43089.1| photosystem II protein M (plastid) [Gordonia brandegeei] gb|ASM43176.1| photosystem II protein M (plastid) [Pyrenaria microcarpa] gb|ASM43263.1| photosystem II protein M (plastid) [Tutcheria championii] gb|ASM43350.1| photosystem II protein M (plastid) [Stewartia crassifolia] gb|ASM43437.1| photosystem II protein M (plastid) [Camellia mairei] gb|ASM43524.1| photosystem II protein M (plastid) [Polyspora longicarpa] gb|ASM43611.1| photosystem II protein M (plastid) [Polyspora dalgleishiana] gb|ASM43698.1| photosystem II protein M (plastid) [Stewartia pteropetiolata] gb|ASM43785.1| photosystem II protein M (plastid) [Pyrenaria hirta var. hirta] gb|ASM43872.1| photosystem II protein M (plastid) [Pyrenaria jonquieriana subsp. multisepala] gb|ASM43892.1| photosystem II protein M (plastid) [Stewartia malacodendron] gb|ASM44046.1| photosystem II protein M (plastid) [Franklinia alatamaha] gb|ASM44133.1| photosystem II protein M (plastid) [Stewartia cordifolia] gb|ASM44220.1| photosystem II protein M (plastid) [Polyspora hainanensis] gb|ASM44307.1| photosystem II protein M (plastid) [Stewartia rubiginosa] gb|ASM44394.1| photosystem II protein M (plastid) [Camellia szechuanensis] gb|ASM44481.1| photosystem II protein M (plastid) [Pyrenaria oblongicarpa] gb|ASM44568.1| photosystem II protein M (plastid) [Stewartia ovata] gb|ASM44655.1| photosystem II protein M (plastid) [Stewartia calcicola] gb|ASM44676.1| photosystem II protein M (plastid) [Schima brevipedicellata] gb|ASM44829.1| photosystem II protein M (plastid) [Pyrenaria hirta var. cordatula] gb|ASM44916.1| photosystem II protein M (plastid) [Stewartia pseudocamellia] gb|ASM44936.1| photosystem II protein M (plastid) [Stewartia rostrata] gb|ASM45090.1| photosystem II protein M (plastid) [Gordonia lasianthus] gb|ASM45177.1| photosystem II protein M (plastid) [Camellia elongata] gb|ASM45264.1| photosystem II protein M (plastid) [Gordonia fruticosa] gb|ASM45351.1| photosystem II protein M (plastid) [Camellia reticulata] gb|ASM45438.1| photosystem II protein M (plastid) [Barringtonia fusicarpa] gb|ASM45525.1| photosystem II protein M (plastid) [Symplocos paniculata] gb|ASM45612.1| photosystem II protein M (plastid) [Diospyros dumetorum] gb|ASM45699.1| photosystem II protein M (plastid) [Pyrenaria diospyricarpa] gb|ASM45786.1| photosystem II protein M (plastid) [Barringtonia racemosa] gb|ASM45873.1| photosystem II protein M (plastid) [Ternstroemia gymnanthera] gb|ASM45960.1| photosystem II protein M (plastid) [Adinandra angustifolia] gb|ASM46047.1| photosystem II protein M (plastid) [Adinandra millettii] gb|ASM46221.1| photosystem II protein M (plastid) [Sladenia celastrifolia] gb|ASM46308.1| photosystem II protein M (plastid) [Diospyros strigosa] gb|ASM46395.1| photosystem II protein M (plastid) [Symplocos costaricana] gb|ASM46482.1| photosystem II protein M (plastid) [Anneslea fragrans] gb|ASM46656.1| photosystem II protein M (plastid) [Sinojackia rehderiana] gb|ASM46741.1| photosystem II protein M (plastid) [Melliodendron xylocarpum] gb|ASO75404.1| photosystem II protein M (chloroplast) [Camellia azalea] gb|ASO76255.1| photosystem II protein M (chloroplast) [Musa itinerans] gb|ASO76670.1| photosystem II protein M (chloroplast) [Solanum dulcamara] gb|ASQ40473.1| photosystem II protein M (chloroplast) [Caryopteris mongholica] gb|ASR92413.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] gb|ASR92500.1| photosystem II protein M (chloroplast) [Solanum lycopersicum] gb|ASR92587.1| photosystem II protein M (chloroplast) [Solanum pennellii] gb|ASS35088.1| photosystem II protein M (chloroplast) [Magnolia insignis] gb|ASU93086.1| PSII low MW protein M (chloroplast) [Pelatantheria scolopendrifolia] gb|ASU93160.1| PSII low MW protein M (chloroplast) [Gastrochilus fuscopunctatus] gb|ASU93234.1| PSII low MW protein M (chloroplast) [Thrixspermum japonicum] gb|ASU93381.1| PSII low MW protein M (chloroplast) [Gastrochilus japonicus] gb|ASV47853.1| photosystem II protein M (chloroplast) [Ambrosia artemisiifolia] gb|ASV47959.1| PSII M protein (chloroplast) [Echinacanthus lofouensis] gb|ASW20433.1| photosystem II protein M (chloroplast) [Alpinia oxyphylla] gb|ASW20516.1| photosystem II protein M (chloroplast) [Conyza bonariensis] gb|ASW26394.1| photosystem II protein M (plastid) [Rheum wittrockii] gb|ASW34572.1| photosystem II protein M (chloroplast) [Nicotiana attenuata] gb|ASX99423.1| photosystem II protein M (chloroplast) [Magnolia laevifolia] gb|ATD53175.1| photosystem II protein M (chloroplast) [Pedicularis cheilanthifolia] gb|ATG24472.1| photosystem II protein M (chloroplast) [Sinowilsonia henryi] gb|ATG27948.1| photosystem II protein M (chloroplast) [Primulina brachytricha var. magnibracteata] gb|ATG28036.1| photosystem II protein M (chloroplast) [Primulina eburnea] gb|ATG28124.1| photosystem II protein M (chloroplast) [Primulina liboensis] gb|ATG83077.1| photosystem II protein M (chloroplast) [Colocasia esculenta] gb|ATI10625.1| photosystem II protein M (chloroplast) [Aristolochia contorta] gb|ATI10710.1| photosystem II protein M (chloroplast) [Aristolochia debilis] emb|CUS18791.1| photosystem II protein M (plastid) [Japonolirion osense] gb|ATI96654.1| photosystem II protein M (chloroplast) [Przewalskia tangutica] gb|ATJ03104.1| photosystem II protein M (chloroplast) [Liparis loeselii] gb|ATJ03197.1| photosystem II protein M (chloroplast) [Cardamine macrophylla] gb|ATL16514.1| photosystem II protein M (chloroplast) [Atractylodes macrocephala] gb|ATL16755.1| photosystem II protein M (chloroplast) [Cirsium japonicum var. maackii] gb|ATL16820.1| photosystem II protein M (chloroplast) [Cirsium japonicum var. spinosissimum] gb|ATL22964.1| PsbM (chloroplast) [Solanum chacoense] gb|ATL23051.1| PsbM (chloroplast) [Solanum hougasii] gb|ATL23138.1| PsbM (chloroplast) [Solanum stoloniferum] gb|ATN40559.1| photosystem II protein M (chloroplast) [Camptotheca acuminata] gb|ATN40576.1| photosystem II protein M (chloroplast) [Portulaca oleracea] gb|PHT53269.1| Photosystem II reaction center protein M [Capsicum baccatum] gb|PHT61372.1| Photosystem II reaction center protein M [Capsicum annuum] gb|PHT62427.1| Photosystem II reaction center protein M [Capsicum annuum] gb|PHT69983.1| Photosystem II reaction center protein M [Capsicum annuum] gb|PHT70436.1| Photosystem II reaction center protein M [Capsicum annuum] gb|PHT74389.1| Photosystem II reaction center protein M [Capsicum annuum] gb|PHT94087.1| Photosystem II reaction center protein M [Capsicum annuum] gb|PHT96867.1| Photosystem II reaction center protein M [Capsicum chinense] gb|PHU29406.1| Photosystem II reaction center protein M [Capsicum chinense] gb|ATP74784.1| photosystem II protein M (chloroplast) [Pleione bulbocodioides] gb|ATQ37743.1| photosystem II protein M (chloroplast) [Littledalea racemosa] gb|ATU06802.1| photosystem II M protein (chloroplast) [Aconitum angustius] gb|ATU06884.1| photosystem II M protein (chloroplast) [Aconitum finetianum] gb|ATU06966.1| photosystem II M protein (chloroplast) [Aconitum sinomontanum] gb|ATU07161.1| photosystem II protein M (chloroplast) [Forsythia suspensa] gb|ATU31917.1| photosystem II protein M (chloroplast) [Quercus tarokoensis] gb|ATV81541.1| PsbM (chloroplast) [Oryza eichingeri] gb|ATV81640.1| PsbM (chloroplast) [Oryza latifolia] gb|ATV81739.1| PsbM (chloroplast) [Oryza rhizomatis] gb|ATV81838.1| PsbM (chloroplast) [Oryza meyeriana] gb|ATV96654.1| photosystem II protein M (chloroplast) [Couroupita guianensis] gb|ATV96745.1| photosystem II protein M (chloroplast) [Couratari stellata] gb|ATV96836.1| photosystem II protein M (chloroplast) [Eschweilera congestiflora] gb|ATV97283.1| photosystem II protein M (chloroplast) [Eschweilera integrifolia] gb|ATV97374.1| photosystem II protein M (chloroplast) [Gustavia augusta] gb|ATV97465.1| photosystem II protein M (chloroplast) [Couratari macrosperma] gb|ATV97647.1| photosystem II protein M (chloroplast) [Corythophora labriculata] gb|ATV97829.1| photosystem II protein M (chloroplast) [Bertholletia excelsa] gb|ATV98011.1| photosystem II protein M (chloroplast) [Lecythis corrugata] gb|ATV98102.1| photosystem II protein M (chloroplast) [Lecythis ampla] gb|ATV98192.1| photosystem II protein M (chloroplast) [Grias cauliflora] gb|ATV98283.1| photosystem II protein M (chloroplast) [Lecythis pneumatophora] gb|ATV98462.1| photosystem II protein M (chloroplast) [Corythophora amapaensis] gb|ATV98552.1| photosystem II protein M (chloroplast) [Barringtonia edulis] gb|ATV98639.1| photosystem II protein M (chloroplast) [Eschweilera caudiculata] gb|ATV95886.1| photosystem II protein M (chloroplast) [Primulina eburnea] gb|ATV95973.1| photosystem II protein M (chloroplast) [Primulina huaijiensis] gb|ATV96060.1| photosystem II protein M (chloroplast) [Primulina linearifolia] gb|ATX68341.1| photosystem II protein M (chloroplast) [Colobanthus apetalus] gb|ATY40682.1| photosystem II protein M (chloroplast) [Symplocos ovatilobata] gb|ATY40838.1| photosystem II protein M (chloroplast) [Saussurea polylepis] gb|ATY47872.1| photosystem II protein M (chloroplast) [Adenocalymma allamandiflorum] gb|ATY47957.1| photosystem II protein M (chloroplast) [Adenocalymma aurantiacum] gb|ATY48041.1| photosystem II protein M (chloroplast) [Adenocalymma biternatum] gb|ATY48126.1| photosystem II protein M (chloroplast) [Adenocalymma bracteatum] gb|ATY48211.1| photosystem II protein M (chloroplast) [Adenocalymma cristicalyx] gb|ATY48296.1| photosystem II protein M (chloroplast) [Adenocalymma hatschbachii] gb|ATY48381.1| photosystem II protein M (chloroplast) [Adenocalymma pedunculatum] gb|ATY48465.1| photosystem II protein M (chloroplast) [Adenocalymma peregrinum] gb|ATY48549.1| photosystem II protein M (chloroplast) [Adenocalymma subspicatum] gb|ATY48634.1| photosystem II protein M (chloroplast) [Neojobertia candolleana] gb|ATY69639.1| photosystem II protein M (chloroplast) [Achyrachaena mollis] gb|AUB29865.1| photosystem II M protein (chloroplast) [Aconitum reclinatum] gb|AUB30061.1| photosystem II protein M (chloroplast) [Actinidia arguta] gb|AUD57892.1| photosystem II protein M (chloroplast) [Landoltia punctata] gb|AUF33264.1| PsbM (chloroplast) [Diplopanax stachyanthus] gb|AUF33604.1| PsbM (chloroplast) [Nyssa wenshanensis] gb|AUF33689.1| PsbM (chloroplast) [Alangium chinense] gb|AUF33774.1| PsbM (chloroplast) [Fouquieria diguetii] gb|AUF33944.1| PsbM (chloroplast) [Curtisia dentata] gb|AUF34029.1| PsbM (chloroplast) [Nyssa sinensis] gb|AUF34114.1| PsbM (chloroplast) [Mastixia caudatilimba] gb|AUF34199.1| PsbM (chloroplast) [Davidia involucrata] gb|AUF34284.1| PsbM (chloroplast) [Alangium alpinum] gb|AUF34369.1| PsbM (chloroplast) [Cornus controversa] gb|AUF34454.1| PsbM (chloroplast) [Camptotheca acuminata] gb|AUG33540.1| photosystem II protein M (chloroplast) [Chenopodium quinoa] gb|AUG60969.1| photosystem II protein M (chloroplast) [Alnus alnobetula subsp. crispa] gb|AUG61054.1| photosystem II protein M (chloroplast) [Alnus alnobetula subsp. suaveolens] gb|AUG61139.1| photosystem II protein M (chloroplast) [Alnus cordata] gb|AUG61224.1| photosystem II protein M (chloroplast) [Alnus alnobetula subsp. alnobetula] gb|AUG61309.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp. betuloides] gb|AUG61394.1| photosystem II protein M (chloroplast) [Alnus cordata] gb|AUG61479.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp. barbata] gb|AUG61564.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp. glutinosa] gb|AUG61714.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp. glutinosa] gb|AUG61734.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp. glutinosa] gb|AUG61819.1| photosystem II protein M (chloroplast) [Alnus incana] gb|AUG62054.1| photosystem II protein M (chloroplast) [Alnus japonica] gb|AUG61904.1| photosystem II protein M (chloroplast) [Alnus incana] gb|AUG62074.1| photosystem II protein M (chloroplast) [Alnus jorullensis subsp. jorullensis] gb|AUG62159.1| photosystem II protein M (chloroplast) [Alnus maritima subsp. maritima] gb|AUG62244.1| photosystem II protein M (chloroplast) [Alnus maritima subsp. maritima] gb|AUG62329.1| photosystem II protein M (chloroplast) [Alnus maritima subsp. oklahomensis] gb|AUG62414.1| photosystem II protein M (chloroplast) [Alnus maximowiczii] gb|AUG62499.1| photosystem II protein M (chloroplast) [Alnus nitida] gb|AUG62649.1| photosystem II protein M (chloroplast) [Alnus orientalis] gb|AUG62669.1| photosystem II protein M (chloroplast) [Alnus rubra] gb|AUG62754.1| photosystem II protein M (chloroplast) [Alnus subcordata] gb|AUJ21985.1| photosystem II protein M (chloroplast) [Oryza coarctata] gb|AUJ22482.1| photosystem II protein M (chloroplast) [Solanum melongena] gb|AUJ22644.1| photosystem II protein M (chloroplast) [Ambrosia artemisiifolia] gb|AUJ22730.1| photosystem II protein M (chloroplast) [Ambrosia trifida] gb|AUJ22814.1| photosystem II protein M (chloroplast) [Nicotiana attenuata] gb|AUL75806.1| photosystem II protein M (plastid) [Oldeania alpina] gb|AUL75889.1| photosystem II protein M (plastid) [Chimonobambusa tumidissinoda] gb|AUL75970.1| photosystem II protein M (plastid) [Ampelocalamus actinotrichus] gb|AUL76052.1| photosystem II protein M (plastid) [Bergbambos tessellata] gb|AUL76135.1| photosystem II protein M (plastid) [Oldeania humbertii] gb|AUL76218.1| photosystem II protein M (plastid) [Oldeania humbertii] gb|AUL76300.1| photosystem II protein M (plastid) [Oldeania ibityensis] gb|AUL76384.1| photosystem II protein M (plastid) [Indocalamus sinicus] gb|AUL76466.1| photosystem II protein M (plastid) [Indosasa shibataeoides] gb|AUL76549.1| photosystem II protein M (plastid) [Oldeania itremoensis] gb|AUL76627.1| photosystem II protein M (plastid) [Kuruna debilis] gb|AUL76714.1| photosystem II protein M (plastid) [Oldeania cf. madagascariensis PFM-2018] gb|AUL76796.1| photosystem II protein M (plastid) [Pseudosasa cantorii] gb|AUL76879.1| photosystem II protein M (plastid) [Sasa longiligulata] gb|AUL76962.1| photosystem II protein M (plastid) [Shibataea chiangshanensis] gb|AUN28376.1| photosystem II protein M (chloroplast) [Genlisea filiformis] gb|AUN28451.1| photosystem II protein M (chloroplast) [Genlisea pygmaea] gb|AUN28526.1| photosystem II protein M (chloroplast) [Genlisea repens] gb|AUN28678.1| photosystem II protein M (chloroplast) [Genlisea violacea] gb|AUO29254.1| photosystem II protein M (chloroplast) [Camellia japonica] gb|AUS83989.1| photosystem II protein M (chloroplast) [Amomum krervanh] gb|AUS84088.1| photosystem II protein M (chloroplast) [Acrocomia aculeata] gb|AUS84241.1| photosystem II protein M (chloroplast) [Quercus tungmaiensis] gb|AUS84843.1| photosystem II protein M (plastid) [Quercus sichourensis] gb|AUT81601.1| photosystem II protein M (plastid) [Cardamine amara] gb|AUT81687.1| photosystem II reaction center protein M (plastid) [Cardamine oligosperma] gb|AUT81773.1| photosystem II reaction center protein M (plastid) [Cardamine parviflora] gb|AUT82126.1| PSII M protein (plastid) [Galeopsis tetrahit] gb|AUT82382.1| PSII M protein (plastid) [Lamium album] gb|AUT82472.1| PSII M protein (plastid) [Lamium galeobdolon] gb|AUT82818.1| photosystem II protein M (plastid) [Ranunculus repens] gb|AUT82903.1| photosystem II reaction center protein M (plastid) [Ranunculus flammula] gb|AUT82988.1| photosystem II protein M (plastid) [Ranunculus reptans] gb|AUT83070.1| photosystem II protein M (plastid) [Silene uniflora] gb|AUT83361.1| photosystem II protein M (plastid) [Carex acutiformis] gb|AUT83419.1| photosystem II protein M (plastid) [Carex flacca] gb|AUT83457.1| photosystem II protein M (plastid) [Carex pallescens] gb|AUT83870.1| photosystem II protein M (chloroplast) [Chionanthus parkinsonii] gb|AUT83958.1| photosystem II protein M (chloroplast) [Chionanthus rupicola] gb|AUT84046.1| photosystem II protein M (chloroplast) [Fontanesia phillyreoides subsp. fortunei] gb|AUT84133.1| photosystem II protein M (chloroplast) [Forestiera isabelae] gb|AUT84221.1| photosystem II protein M (chloroplast) [Forsythia x intermedia] gb|AUT84307.1| photosystem II protein M (chloroplast) [Fraxinus ornus] gb|AUT84395.1| photosystem II protein M (chloroplast) [Nestegis apetala] gb|AUT84483.1| photosystem II protein M (chloroplast) [Noronhia lowryi] gb|AUT84571.1| photosystem II protein M (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84658.1| photosystem II protein M (chloroplast) [Olea europaea subsp. europaea] gb|AUT84747.1| photosystem II protein M (chloroplast) [Olea europaea subsp. europaea] gb|AUT84835.1| photosystem II protein M (chloroplast) [Olea europaea subsp. europaea] gb|AUT84923.1| photosystem II protein M (chloroplast) [Olea europaea subsp. guanchica] gb|AUT85011.1| photosystem II protein M (chloroplast) [Olea europaea subsp. laperrinei] gb|AUT85098.1| photosystem II protein M (chloroplast) [Olea exasperata] gb|AUT85186.1| photosystem II protein M (chloroplast) [Schrebera arborea] gb|AUT85274.1| photosystem II protein M (chloroplast) [Syringa vulgaris] gb|AUW35021.1| photosystem II protein M (chloroplast) [Amomum compactum] gb|AUW35403.1| photosystem II protein M (chloroplast) [Magnolia aromatica] gb|AUW35489.1| photosystem II protein M (chloroplast) [Magnolia fordiana var. calcarea] gb|AUW35575.1| photosystem II protein M (chloroplast) [Magnolia conifera] gb|AUW35661.1| photosystem II protein M (chloroplast) [Magnolia duclouxii] gb|AUW35747.1| photosystem II protein M (chloroplast) [Magnolia glaucifolia] gb|AUW35833.1| photosystem II protein M (chloroplast) [Magnolia insignis] gb|AUW35919.1| photosystem II protein M (chloroplast) [Magnolia dandyi] gb|AUW36005.1| photosystem II protein M (chloroplast) [Magnolia alba] gb|AVA07782.1| photosystem II protein M (chloroplast) [Prosphytochloa prehensilis] gb|AVA08534.1| photosystem II protein M (chloroplast) [Drepanostachyum falcatum] gb|AVA08929.1| photosystem II protein M (chloroplast) [Scutellaria baicalensis] gb|AVA09016.1| photosystem II protein M (chloroplast) [Scutellaria baicalensis] gb|AVA09390.1| photosystem II protein M (plastid) [Fraxinus chiisanensis] gb|AVC55536.1| PsbM (chloroplast) [Streptocarpus teitensis] gb|AVD53924.1| PsbM (chloroplast) [Asarum sieboldii] gb|AVD96766.1| photosystem II protein M (chloroplast) [Anemoclema glaucifolium] gb|AVE14934.1| PSII M protein (chloroplast) [Forsythia saxatilis] gb|AVF97078.1| photosystem II protein M (chloroplast) [Anemopaegma acutifolium] gb|AVF97176.1| photosystem II protein M (chloroplast) [Anemopaegma acutifolium] gb|AVF97274.1| photosystem II protein M (chloroplast) [Anemopaegma album] gb|AVF97372.1| photosystem II protein M (chloroplast) [Anemopaegma arvense] gb|AVF97470.1| photosystem II protein M (chloroplast) [Anemopaegma arvense] gb|AVF97568.1| photosystem II protein M (chloroplast) [Anemopaegma chamberlaynii] gb|AVF97666.1| photosystem II protein M (chloroplast) [Anemopaegma foetidum] gb|AVF97764.1| photosystem II protein M (chloroplast) [Anemopaegma glaucum] gb|AVF97862.1| photosystem II protein M (chloroplast) [Anemopaegma glaucum] gb|AVF97960.1| photosystem II protein M (chloroplast) [Anemopaegma oligoneuron] gb|AVI15290.1| photosystem II protein M (chloroplast) [Parrotia subaequalis] gb|AVI15377.1| photosystem II protein M (chloroplast) [Parrotia subaequalis] gb|AVI15647.1| PsbM (chloroplast) [Oryza sativa] gb|AVI16381.1| photosystem II M protein (chloroplast) [Mentha spicata] gb|AVI16554.1| photosystem II protein M (chloroplast) [Camellia oleifera] gb|AVI26173.1| photosystem II protein M (chloroplast) [Castanopsis hainanensis] gb|AVK42911.1| photosystem II protein M (chloroplast) [Conyza bonariensis] gb|AVK80167.1| photosystem II protein M (chloroplast) [Pedicularis hallaisanensis] gb|AVM10641.1| photosystem II protein M (chloroplast) [Epipactis mairei] gb|AVM38732.1| photosystem II protein M (chloroplast) [Fraxinus excelsior] gb|AVM81558.1| photosystem II protein M (chloroplast) [Adenocalymma marginatum] gb|AVM81641.1| photosystem II protein M (chloroplast) [Adenocalymma nodosum] gb|AVM81726.1| photosystem II protein M (chloroplast) [Adenocalymma trifoliatum] gb|AVM81811.1| photosystem II protein M (chloroplast) [Dolichandra cynanchoides] gb|AVM81896.1| photosystem II protein M (chloroplast) [Pleonotoma albiflora] gb|AVM81981.1| photosystem II protein M (chloroplast) [Tecomaria capensis] gb|AVM82069.1| photosystem II protein M (chloroplast) [Adenocalymma acutissimum] gb|AVM82149.1| photosystem II protein M (chloroplast) [Adenocalymma cymbalum] gb|AVM82235.1| photosystem II protein M (chloroplast) [Adenocalymma juliae] gb|AVM82320.1| photosystem II protein M (chloroplast) [Adenocalymma macrophyllum] gb|AVM82407.1| photosystem II protein M (chloroplast) [Adenocalymma scabriusculum] gb|AVM82493.1| photosystem II protein M (chloroplast) [Adenocalymma subsessilifolium] gb|AVM82592.1| photosystem II protein M (chloroplast) [Anemopaegma arvense] gb|AVM82674.1| photosystem II protein M (chloroplast) [Cuspidaria floribunda] gb|AVM82759.1| photosystem II protein M (chloroplast) [Podranea ricasoliana] gb|AVM82856.1| photosystem II protein M (chloroplast) [Pyrostegia venusta] gb|AVM82938.1| photosystem II protein M (chloroplast) [Adenocalymma ackermannii] gb|AVM83018.1| photosystem II protein M (chloroplast) [Adenocalymma adenophorum] gb|AVM83094.1| photosystem II protein M (chloroplast) [Adenocalymma apurense] gb|AVM83171.1| photosystem II protein M (chloroplast) [Adenocalymma calcareum] gb|AVM83257.1| photosystem II protein M (chloroplast) [Adenocalymma cinereum] gb|AVM83341.1| photosystem II protein M (chloroplast) [Adenocalymma cladotrichum] gb|AVM83428.1| photosystem II protein M (chloroplast) [Adenocalymma coriaceum] gb|AVM83510.1| photosystem II protein M (chloroplast) [Adenocalymma dichilum] gb|AVM83595.1| photosystem II protein M (chloroplast) [Adenocalymma dusenii] gb|AVM83672.1| photosystem II protein M (chloroplast) [Adenocalymma flaviflorum] gb|AVM83752.1| photosystem II protein M (chloroplast) [Adenocalymma gibbosum] gb|AVM83840.1| photosystem II protein M (chloroplast) [Adenocalymma gracielzae] gb|AVM83920.1| photosystem II protein M (chloroplast) [Adenocalymma grandifolium] gb|AVM84006.1| photosystem II protein M (chloroplast) [Adenocalymma hatschbachii] gb|AVM84085.1| photosystem II protein M (chloroplast) [Adenocalymma hypostictum] gb|AVM84163.1| photosystem II protein M (chloroplast) [Adenocalymma paulistarum] gb|AVM84246.1| photosystem II protein M (chloroplast) [Adenocalymma pubescens] gb|AVM84325.1| photosystem II protein M (chloroplast) [Adenocalymma schomburgkii] gb|AVM84386.1| photosystem II protein M (chloroplast) [Adenocalymma subincanum] gb|AVM84454.1| photosystem II protein M (chloroplast) [Adenocalymma ubatubense] gb|AVM84539.1| photosystem II protein M (chloroplast) [Adenocalymma validum] gb|AVM84620.1| photosystem II protein M (chloroplast) [Fridericia platyphylla] gb|AVM84705.1| photosystem II protein M (chloroplast) [Sampaiella trichoclada] gb|AVN88364.1| photosystem II protein M (chloroplast) [Asarum canadense] gb|AVN89976.1| photosystem II protein M (chloroplast) [Camellia chekiangoleosa] gb|AVN90057.1| photosystem II protein M (chloroplast) [Helianthus tuberosus] gb|AVN97916.1| photosystem II protein M (chloroplast) [Alnus rubra] gb|AVN98010.1| photosystem II protein M (chloroplast) [Betula cordifolia] prf||1603356M photosystem II low MW protein [Oryza sativa] Length = 34 Score = 66.6 bits (161), Expect = 3e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34 >ref|YP_009407099.1| photosystem II protein M (chloroplast) [Platycarya strobilacea] gb|ASA45980.1| photosystem II protein M (chloroplast) [Platycarya strobilacea] Length = 37 Score = 66.6 bits (161), Expect = 3e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34 >gb|ATV97192.1| photosystem II protein M (chloroplast) [Allantoma lineata] gb|ATV97920.1| photosystem II protein M (chloroplast) [Allantoma decandra] Length = 38 Score = 66.6 bits (161), Expect = 3e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34 >ref|YP_009375686.1| PsbM (chloroplast) [Diplostephium phylicoides] ref|YP_009376111.1| PsbM (chloroplast) [Diplostephium lacunosum] gb|ARH06166.1| PsbM (chloroplast) [Diplostephium phylicoides] gb|ARH06591.1| PsbM (chloroplast) [Diplostephium lacunosum] Length = 34 Score = 66.2 bits (160), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 MEVNILAF+ATALFILVPTAFLLIIYVKTVSQND Sbjct: 1 MEVNILAFVATALFILVPTAFLLIIYVKTVSQND 34 >gb|AKZ30297.1| photosystem II protein M (chloroplast) [Goodenia ovata] Length = 34 Score = 66.2 bits (160), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 264 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 163 MEVNILAFIATALF+LVPTAFLLIIYVKTVSQND Sbjct: 1 MEVNILAFIATALFVLVPTAFLLIIYVKTVSQND 34