BLASTX nr result
ID: Rehmannia30_contig00027491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027491 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN06623.1| hypothetical protein CDL12_20823 [Handroanthus im... 124 4e-30 ref|XP_011100099.1| general transcription factor 3C polypeptide ... 122 3e-29 ref|XP_011100078.1| general transcription factor 3C polypeptide ... 122 3e-29 gb|EYU41226.1| hypothetical protein MIMGU_mgv1a017814mg [Erythra... 115 7e-27 ref|XP_012832828.1| PREDICTED: general transcription factor 3C p... 115 7e-27 ref|XP_014619932.1| PREDICTED: general transcription factor 3C p... 115 1e-26 ref|XP_014619929.1| PREDICTED: general transcription factor 3C p... 115 1e-26 gb|KRH24198.1| hypothetical protein GLYMA_12G027700 [Glycine max] 115 1e-26 gb|KHN05439.1| General transcription factor 3C polypeptide 3 [Gl... 115 1e-26 ref|XP_006592051.1| PREDICTED: general transcription factor 3C p... 115 1e-26 ref|XP_014493753.1| general transcription factor 3C polypeptide ... 114 3e-26 ref|XP_022633526.1| general transcription factor 3C polypeptide ... 114 3e-26 ref|XP_014493752.1| general transcription factor 3C polypeptide ... 114 3e-26 ref|XP_010645085.1| PREDICTED: general transcription factor 3C p... 113 4e-26 emb|CBI24131.3| unnamed protein product, partial [Vitis vinifera] 113 4e-26 ref|XP_018834164.1| PREDICTED: general transcription factor 3C p... 113 6e-26 gb|KOM51051.1| hypothetical protein LR48_Vigan08g187800 [Vigna a... 112 1e-25 ref|XP_020214773.1| general transcription factor 3C polypeptide ... 112 1e-25 ref|XP_017433688.1| PREDICTED: transcription factor tau subunit ... 112 1e-25 ref|XP_007131656.1| hypothetical protein PHAVU_011G031000g [Phas... 112 2e-25 >gb|PIN06623.1| hypothetical protein CDL12_20823 [Handroanthus impetiginosus] Length = 616 Score = 124 bits (312), Expect = 4e-30 Identities = 59/65 (90%), Positives = 61/65 (93%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLAIHEKDYPIPILP+DNP+LM KPGYCDLRREAAYNLHLIYKKSGA DLARQVLK Sbjct: 552 EKVLAIHEKDYPIPILPSDNPELMTVNKPGYCDLRREAAYNLHLIYKKSGAFDLARQVLK 611 Query: 306 DHVVL 292 DHVVL Sbjct: 612 DHVVL 616 >ref|XP_011100099.1| general transcription factor 3C polypeptide 3 isoform X2 [Sesamum indicum] Length = 814 Score = 122 bits (307), Expect = 3e-29 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLAI EKDYPIP+LPN+N D +D KKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 750 EKVLAIREKDYPIPVLPNENQDHVDDKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 809 Query: 306 DHVVL 292 DHVVL Sbjct: 810 DHVVL 814 >ref|XP_011100078.1| general transcription factor 3C polypeptide 3 isoform X1 [Sesamum indicum] ref|XP_011100087.1| general transcription factor 3C polypeptide 3 isoform X1 [Sesamum indicum] ref|XP_011100094.1| general transcription factor 3C polypeptide 3 isoform X1 [Sesamum indicum] Length = 949 Score = 122 bits (307), Expect = 3e-29 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLAI EKDYPIP+LPN+N D +D KKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 885 EKVLAIREKDYPIPVLPNENQDHVDDKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 944 Query: 306 DHVVL 292 DHVVL Sbjct: 945 DHVVL 949 >gb|EYU41226.1| hypothetical protein MIMGU_mgv1a017814mg [Erythranthe guttata] Length = 877 Score = 115 bits (289), Expect = 7e-27 Identities = 56/65 (86%), Positives = 58/65 (89%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLAI EKDYPIPILPNDNP K+PGYCDLRREAAYNLHLIYKKSGA DLARQVLK Sbjct: 813 EKVLAIREKDYPIPILPNDNPCDSGIKRPGYCDLRREAAYNLHLIYKKSGAFDLARQVLK 872 Query: 306 DHVVL 292 DH+VL Sbjct: 873 DHLVL 877 >ref|XP_012832828.1| PREDICTED: general transcription factor 3C polypeptide 3 [Erythranthe guttata] Length = 948 Score = 115 bits (289), Expect = 7e-27 Identities = 56/65 (86%), Positives = 58/65 (89%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLAI EKDYPIPILPNDNP K+PGYCDLRREAAYNLHLIYKKSGA DLARQVLK Sbjct: 884 EKVLAIREKDYPIPILPNDNPCDSGIKRPGYCDLRREAAYNLHLIYKKSGAFDLARQVLK 943 Query: 306 DHVVL 292 DH+VL Sbjct: 944 DHLVL 948 >ref|XP_014619932.1| PREDICTED: general transcription factor 3C polypeptide 3-like isoform X4 [Glycine max] Length = 755 Score = 115 bits (287), Expect = 1e-26 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKDYPIP LPN+NPD +++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 691 EKVIAICEKDYPIPKLPNENPDSIETHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 750 Query: 306 DHVVL 292 DH L Sbjct: 751 DHCTL 755 >ref|XP_014619929.1| PREDICTED: general transcription factor 3C polypeptide 3-like isoform X2 [Glycine max] Length = 882 Score = 115 bits (287), Expect = 1e-26 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKDYPIP LPN+NPD +++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 818 EKVIAICEKDYPIPKLPNENPDSIETHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 877 Query: 306 DHVVL 292 DH L Sbjct: 878 DHCTL 882 >gb|KRH24198.1| hypothetical protein GLYMA_12G027700 [Glycine max] Length = 916 Score = 115 bits (287), Expect = 1e-26 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKDYPIP LPN+NPD +++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 852 EKVIAICEKDYPIPKLPNENPDSIETHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 911 Query: 306 DHVVL 292 DH L Sbjct: 912 DHCTL 916 >gb|KHN05439.1| General transcription factor 3C polypeptide 3 [Glycine soja] Length = 917 Score = 115 bits (287), Expect = 1e-26 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKDYPIP LPN+NPD +++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 853 EKVIAICEKDYPIPKLPNENPDSIETHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 912 Query: 306 DHVVL 292 DH L Sbjct: 913 DHCTL 917 >ref|XP_006592051.1| PREDICTED: general transcription factor 3C polypeptide 3-like isoform X1 [Glycine max] ref|XP_006592052.1| PREDICTED: general transcription factor 3C polypeptide 3-like isoform X1 [Glycine max] gb|KRH24199.1| hypothetical protein GLYMA_12G027700 [Glycine max] gb|KRH24200.1| hypothetical protein GLYMA_12G027700 [Glycine max] gb|KRH24201.1| hypothetical protein GLYMA_12G027700 [Glycine max] Length = 918 Score = 115 bits (287), Expect = 1e-26 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKDYPIP LPN+NPD +++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 854 EKVIAICEKDYPIPKLPNENPDSIETHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 913 Query: 306 DHVVL 292 DH L Sbjct: 914 DHCTL 918 >ref|XP_014493753.1| general transcription factor 3C polypeptide 3 isoform X3 [Vigna radiata var. radiata] Length = 804 Score = 114 bits (284), Expect = 3e-26 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKD PIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 740 EKVIAIREKDCPIPKLPNENPDVIENHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 799 Query: 306 DHVVL 292 DH L Sbjct: 800 DHCTL 804 >ref|XP_022633526.1| general transcription factor 3C polypeptide 3 isoform X2 [Vigna radiata var. radiata] Length = 864 Score = 114 bits (284), Expect = 3e-26 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKD PIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 800 EKVIAIREKDCPIPKLPNENPDVIENHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 859 Query: 306 DHVVL 292 DH L Sbjct: 860 DHCTL 864 >ref|XP_014493752.1| general transcription factor 3C polypeptide 3 isoform X1 [Vigna radiata var. radiata] Length = 913 Score = 114 bits (284), Expect = 3e-26 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI EKD PIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 849 EKVIAIREKDCPIPKLPNENPDVIENHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 908 Query: 306 DHVVL 292 DH L Sbjct: 909 DHCTL 913 >ref|XP_010645085.1| PREDICTED: general transcription factor 3C polypeptide 3 isoform X1 [Vitis vinifera] Length = 907 Score = 113 bits (283), Expect = 4e-26 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLA HE+DYPIP LP +N DL++++KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 843 EKVLATHERDYPIPRLPYENTDLVENRKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 902 Query: 306 DHVVL 292 DH + Sbjct: 903 DHCTI 907 >emb|CBI24131.3| unnamed protein product, partial [Vitis vinifera] Length = 915 Score = 113 bits (283), Expect = 4e-26 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLA HE+DYPIP LP +N DL++++KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 851 EKVLATHERDYPIPRLPYENTDLVENRKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 910 Query: 306 DHVVL 292 DH + Sbjct: 911 DHCTI 915 >ref|XP_018834164.1| PREDICTED: general transcription factor 3C polypeptide 3 isoform X1 [Juglans regia] Length = 916 Score = 113 bits (282), Expect = 6e-26 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKVLA HEKDYPIP LP ++PD+++++KPGYCDLRREAAYNLHLIYKKSGA DLARQVLK Sbjct: 852 EKVLATHEKDYPIPKLPCEDPDIVENRKPGYCDLRREAAYNLHLIYKKSGAFDLARQVLK 911 Query: 306 DHVVL 292 DH + Sbjct: 912 DHCTI 916 >gb|KOM51051.1| hypothetical protein LR48_Vigan08g187800 [Vigna angularis] Length = 852 Score = 112 bits (280), Expect = 1e-25 Identities = 52/65 (80%), Positives = 58/65 (89%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+ I EKD PIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 788 EKVIGIREKDCPIPKLPNENPDVIENHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 847 Query: 306 DHVVL 292 DH L Sbjct: 848 DHCTL 852 >ref|XP_020214773.1| general transcription factor 3C polypeptide 3 [Cajanus cajan] gb|KYP68386.1| hypothetical protein KK1_022010 [Cajanus cajan] Length = 915 Score = 112 bits (280), Expect = 1e-25 Identities = 51/65 (78%), Positives = 60/65 (92%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+AI ++DYPIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYK+SGALDLARQVLK Sbjct: 851 EKVIAICQRDYPIPKLPNENPDVVENLKPGYCDLRREAAYNLHLIYKRSGALDLARQVLK 910 Query: 306 DHVVL 292 DH L Sbjct: 911 DHCTL 915 >ref|XP_017433688.1| PREDICTED: transcription factor tau subunit sfc4 [Vigna angularis] dbj|BAT91089.1| hypothetical protein VIGAN_06239500 [Vigna angularis var. angularis] Length = 916 Score = 112 bits (280), Expect = 1e-25 Identities = 52/65 (80%), Positives = 58/65 (89%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+ I EKD PIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYKKSGALDLARQVLK Sbjct: 852 EKVIGIREKDCPIPKLPNENPDVIENHKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 911 Query: 306 DHVVL 292 DH L Sbjct: 912 DHCTL 916 >ref|XP_007131656.1| hypothetical protein PHAVU_011G031000g [Phaseolus vulgaris] gb|ESW03650.1| hypothetical protein PHAVU_011G031000g [Phaseolus vulgaris] Length = 917 Score = 112 bits (279), Expect = 2e-25 Identities = 50/65 (76%), Positives = 59/65 (90%) Frame = -2 Query: 486 EKVLAIHEKDYPIPILPNDNPDLMDSKKPGYCDLRREAAYNLHLIYKKSGALDLARQVLK 307 EKV+ I EKDYPIP LPN+NPD++++ KPGYCDLRREAAYNLHLIYKKSGA+DLARQ+L+ Sbjct: 853 EKVIGIGEKDYPIPKLPNENPDVIENHKPGYCDLRREAAYNLHLIYKKSGAIDLARQLLR 912 Query: 306 DHVVL 292 DH L Sbjct: 913 DHCTL 917