BLASTX nr result
ID: Rehmannia30_contig00027431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027431 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB51517.1| hypothetical protein B456_008G221600 [Gossypium r... 55 5e-06 >gb|KJB51517.1| hypothetical protein B456_008G221600 [Gossypium raimondii] Length = 221 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -3 Query: 489 EEAHLNTCFKHFILFTCVSFLILQISVAIYVAWSYNFWF 373 EEAHLNTCFKHFILFTCVS +L + + Y+ +S F + Sbjct: 175 EEAHLNTCFKHFILFTCVSLFLLLLDIHTYIYYSLPFHY 213