BLASTX nr result
ID: Rehmannia30_contig00027418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027418 (988 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKV71949.1| R2R3-MYB protein [Rehmannia glutinosa] 67 4e-09 >gb|AKV71949.1| R2R3-MYB protein [Rehmannia glutinosa] Length = 247 Score = 67.0 bits (162), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 683 SDSRLLPENYFASDLNMENQSDFWLDVFYR 772 SDSRLLPENYFASDLNMENQSDFWLDVFYR Sbjct: 208 SDSRLLPENYFASDLNMENQSDFWLDVFYR 237