BLASTX nr result
ID: Rehmannia30_contig00027349
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027349 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42024.1| hypothetical protein MIMGU_mgv1a025364mg, partial... 62 2e-08 ref|XP_012832276.1| PREDICTED: uncharacterized protein LOC105953... 63 2e-08 gb|PIN21374.1| hypothetical protein CDL12_05919 [Handroanthus im... 63 2e-08 ref|XP_011095142.1| uncharacterized protein LOC105174668 [Sesamu... 57 2e-06 >gb|EYU42024.1| hypothetical protein MIMGU_mgv1a025364mg, partial [Erythranthe guttata] Length = 203 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 527 GSNEMFLVVQNEGEIPLKVNVNLPNYLTNDLPVLDVPKHKTRR 399 GS MF+VVQNEGEI LKV ++LPNYL N +P +VPKH++ R Sbjct: 161 GSKNMFVVVQNEGEITLKVTLSLPNYLKNGMPAFEVPKHESNR 203 >ref|XP_012832276.1| PREDICTED: uncharacterized protein LOC105953188 [Erythranthe guttata] Length = 355 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 527 GSNEMFLVVQNEGEIPLKVNVNLPNYLTNDLPVLDVPKHKTRRV 396 GS MF+VVQNEGEI LKV ++LPNYL N +P +VPKH++ R+ Sbjct: 161 GSKNMFVVVQNEGEITLKVTLSLPNYLKNGMPAFEVPKHESNRI 204 >gb|PIN21374.1| hypothetical protein CDL12_05919 [Handroanthus impetiginosus] Length = 358 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 527 GSNEMFLVVQNEGEIPLKVNVNLPNYLTNDLPVLDVPKHKTRR 399 GS E+FLVV+NEG+ LKVN+N PNYL NDLP +VP+H+ +R Sbjct: 166 GSKEVFLVVKNEGKSTLKVNINSPNYLKNDLPAFEVPEHQIKR 208 >ref|XP_011095142.1| uncharacterized protein LOC105174668 [Sesamum indicum] Length = 349 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -1 Query: 530 TGSNEMFLVVQNEGEIPLKVNVNLPNYLTNDLPVLDVPKHKTRRV 396 +G+ ++FLVVQN+GE LKVN+NLPN L N LP +V KHKTR++ Sbjct: 165 SGTKQLFLVVQNKGESTLKVNINLPN-LDNALPAFEVSKHKTRQM 208