BLASTX nr result
ID: Rehmannia30_contig00027339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027339 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020551742.1| AP-1 complex subunit gamma-2 isoform X2 [Ses... 93 9e-19 ref|XP_011086531.1| AP-1 complex subunit gamma-2 isoform X1 [Ses... 93 9e-19 ref|XP_019176734.1| PREDICTED: AP-1 complex subunit gamma-2-like... 91 6e-18 gb|PIN16861.1| Vesicle coat complex AP-1, gamma subunit [Handroa... 90 1e-17 ref|XP_016572707.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 2e-17 ref|XP_016572706.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 2e-17 ref|XP_012846556.1| PREDICTED: AP-1 complex subunit gamma-2 [Ery... 89 3e-17 ref|XP_018622797.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_019261331.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_016491055.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_016488218.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_009774151.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_009588529.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_016491054.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_016488217.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_009774150.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_009588528.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_019158087.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_016491053.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 ref|XP_009774148.1| PREDICTED: AP-1 complex subunit gamma-2-like... 89 3e-17 >ref|XP_020551742.1| AP-1 complex subunit gamma-2 isoform X2 [Sesamum indicum] Length = 875 Score = 92.8 bits (229), Expect = 9e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR+SNSQHGKKSLVMR+RISYKAN KDVLEEGQ+NNFP GL Sbjct: 827 GNGSITQKLRVSNSQHGKKSLVMRMRISYKANDKDVLEEGQVNNFPRGL 875 >ref|XP_011086531.1| AP-1 complex subunit gamma-2 isoform X1 [Sesamum indicum] Length = 877 Score = 92.8 bits (229), Expect = 9e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR+SNSQHGKKSLVMR+RISYKAN KDVLEEGQ+NNFP GL Sbjct: 829 GNGSITQKLRVSNSQHGKKSLVMRMRISYKANDKDVLEEGQVNNFPRGL 877 >ref|XP_019176734.1| PREDICTED: AP-1 complex subunit gamma-2-like [Ipomoea nil] Length = 878 Score = 90.5 bits (223), Expect = 6e-18 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR+ NSQHGKKSLVMR+RI YK NGKDVLEEGQINNFP GL Sbjct: 830 GNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 878 >gb|PIN16861.1| Vesicle coat complex AP-1, gamma subunit [Handroanthus impetiginosus] Length = 877 Score = 89.7 bits (221), Expect = 1e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR+SNSQHGKKSLVMRIRISYKAN KDVLEEGQ+N+FP L Sbjct: 829 GNGSITQKLRVSNSQHGKKSLVMRIRISYKANNKDVLEEGQVNSFPRDL 877 >ref|XP_016572707.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X2 [Capsicum annuum] Length = 876 Score = 89.0 bits (219), Expect = 2e-17 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLRI+NSQHGKKSLVMRIR+SYK N KDVLEEGQINNFP L Sbjct: 828 GNGSITQKLRITNSQHGKKSLVMRIRVSYKVNDKDVLEEGQINNFPRDL 876 >ref|XP_016572706.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X1 [Capsicum annuum] Length = 878 Score = 89.0 bits (219), Expect = 2e-17 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLRI+NSQHGKKSLVMRIR+SYK N KDVLEEGQINNFP L Sbjct: 830 GNGSITQKLRITNSQHGKKSLVMRIRVSYKVNDKDVLEEGQINNFPRDL 878 >ref|XP_012846556.1| PREDICTED: AP-1 complex subunit gamma-2 [Erythranthe guttata] gb|EYU29716.1| hypothetical protein MIMGU_mgv1a001222mg [Erythranthe guttata] Length = 863 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSI+QKLR+SNSQHGKKSLVMR+RISY+AN KDVLEEGQI+NFP GL Sbjct: 815 GNGSISQKLRVSNSQHGKKSLVMRMRISYQANNKDVLEEGQISNFPRGL 863 >ref|XP_018622797.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X3 [Nicotiana tomentosiformis] Length = 872 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 824 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 872 >ref|XP_019261331.1| PREDICTED: AP-1 complex subunit gamma-2-like [Nicotiana attenuata] gb|OIT38579.1| ap-1 complex subunit gamma-2 [Nicotiana attenuata] Length = 877 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 829 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 877 >ref|XP_016491055.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X4 [Nicotiana tabacum] Length = 877 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 829 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 877 >ref|XP_016488218.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X2 [Nicotiana tabacum] Length = 877 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 829 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 877 >ref|XP_009774151.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X5 [Nicotiana sylvestris] Length = 877 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 829 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 877 >ref|XP_009588529.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X2 [Nicotiana tomentosiformis] Length = 877 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 829 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 877 >ref|XP_016491054.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X3 [Nicotiana tabacum] Length = 879 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 831 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 879 >ref|XP_016488217.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X1 [Nicotiana tabacum] Length = 879 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 831 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 879 >ref|XP_009774150.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X4 [Nicotiana sylvestris] Length = 879 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 831 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 879 >ref|XP_009588528.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X1 [Nicotiana tomentosiformis] Length = 879 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 831 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 879 >ref|XP_019158087.1| PREDICTED: AP-1 complex subunit gamma-2-like [Ipomoea nil] Length = 880 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKSLVMR RI YK N KDVLEEGQINNFP GL Sbjct: 832 GNGSITQKLRVTNSQHGKKSLVMRTRIGYKVNNKDVLEEGQINNFPRGL 880 >ref|XP_016491053.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X2 [Nicotiana tabacum] Length = 920 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 872 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 920 >ref|XP_009774148.1| PREDICTED: AP-1 complex subunit gamma-2-like isoform X2 [Nicotiana sylvestris] Length = 920 Score = 88.6 bits (218), Expect = 3e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 GNGSITQKLRISNSQHGKKSLVMRIRISYKANGKDVLEEGQINNFPGGL 147 GNGSITQKLR++NSQHGKKS+VMRIRISYK N KDVLEEGQINNFP L Sbjct: 872 GNGSITQKLRVTNSQHGKKSIVMRIRISYKVNNKDVLEEGQINNFPRDL 920