BLASTX nr result
ID: Rehmannia30_contig00027322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00027322 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020553892.1| probable UDP-3-O-acylglucosamine N-acyltrans... 77 9e-14 ref|XP_012848696.1| PREDICTED: probable UDP-3-O-acylglucosamine ... 74 1e-12 gb|PIN03121.1| UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltra... 71 2e-12 >ref|XP_020553892.1| probable UDP-3-O-acylglucosamine N-acyltransferase 2, mitochondrial [Sesamum indicum] Length = 295 Score = 77.4 bits (189), Expect = 9e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 514 EAGDYGGFPAIPIHDWRKQVVSVRQISKEFWHQKKT 407 EAGDYGGFPA+PIH+WRKQVVSVRQISKEFWH KKT Sbjct: 260 EAGDYGGFPAMPIHEWRKQVVSVRQISKEFWHHKKT 295 >ref|XP_012848696.1| PREDICTED: probable UDP-3-O-acylglucosamine N-acyltransferase 2, mitochondrial [Erythranthe guttata] gb|EYU27834.1| hypothetical protein MIMGU_mgv1a011078mg [Erythranthe guttata] Length = 293 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 514 EAGDYGGFPAIPIHDWRKQVVSVRQISKEFWHQKKTKS 401 EAGDYGGFPAIPIH+WRKQVVSVRQ SKEFW+ +K KS Sbjct: 250 EAGDYGGFPAIPIHEWRKQVVSVRQTSKEFWYHRKMKS 287 >gb|PIN03121.1| UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase [Handroanthus impetiginosus] Length = 152 Score = 71.2 bits (173), Expect = 2e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 514 EAGDYGGFPAIPIHDWRKQVVSVRQISKEFWHQKKTKS 401 EAGDYGGFPA+PIH+WRKQV SVRQIS+EF H KK KS Sbjct: 106 EAGDYGGFPAVPIHEWRKQVASVRQISEEFQHHKKMKS 143