BLASTX nr result
ID: Rehmannia30_contig00026753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026753 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26139.1| Nucleotide-sugar transporter VRG4/SQV-7 [Handroan... 109 4e-25 gb|KZV22172.1| hypothetical protein F511_27342, partial [Dorcoce... 92 8e-19 ref|XP_011090177.1| GDP-mannose transporter GONST1 isoform X1 [S... 89 2e-17 ref|XP_012838445.1| PREDICTED: GDP-mannose transporter GONST1-li... 84 6e-16 ref|XP_022898345.1| GDP-mannose transporter GONST1-like isoform ... 81 1e-14 ref|XP_022897972.1| GDP-mannose transporter GONST1-like isoform ... 80 2e-14 ref|XP_022897970.1| GDP-mannose transporter GONST1-like isoform ... 80 2e-14 ref|XP_020550138.1| GDP-mannose transporter GONST1-like isoform ... 79 2e-14 ref|XP_011080450.1| GDP-mannose transporter GONST1-like isoform ... 79 4e-14 ref|XP_021636726.1| GDP-mannose transporter GONST1-like isoform ... 76 5e-13 gb|PHU03127.1| GDP-mannose transporter GONST1, partial [Capsicum... 75 1e-12 gb|PHT68540.1| GDP-mannose transporter GONST1, partial [Capsicum... 75 1e-12 ref|XP_016542725.1| PREDICTED: GDP-mannose transporter GONST1-li... 75 1e-12 ref|XP_016542724.1| PREDICTED: GDP-mannose transporter GONST1-li... 75 1e-12 ref|XP_016441323.1| PREDICTED: GDP-mannose transporter GONST1-li... 75 2e-12 ref|XP_009760359.1| PREDICTED: GDP-mannose transporter GONST1 is... 75 2e-12 ref|XP_016441322.1| PREDICTED: GDP-mannose transporter GONST1-li... 75 2e-12 ref|XP_009760358.1| PREDICTED: GDP-mannose transporter GONST1 is... 75 2e-12 ref|XP_010649370.1| PREDICTED: GDP-mannose transporter GONST1 is... 74 2e-12 emb|CBI37536.3| unnamed protein product, partial [Vitis vinifera] 74 3e-12 >gb|PIN26139.1| Nucleotide-sugar transporter VRG4/SQV-7 [Handroanthus impetiginosus] Length = 398 Score = 109 bits (273), Expect = 4e-25 Identities = 53/75 (70%), Positives = 64/75 (85%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRN 47 NHQL G DQV VRREIASRSF MKTP+NN++ID+E+G+ GKD EKA++S+R+LT+ N Sbjct: 40 NHQLYGLPDQVSSPVRREIASRSFGMKTPSNNDEIDMESGRFGKDREKAVQSKRVLTIHN 99 Query: 46 PALLSGLAYCFSSCS 2 ALLSGLAYCFSSCS Sbjct: 100 KALLSGLAYCFSSCS 114 >gb|KZV22172.1| hypothetical protein F511_27342, partial [Dorcoceras hygrometricum] Length = 392 Score = 92.4 bits (228), Expect = 8e-19 Identities = 47/76 (61%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASR-SFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVR 50 NHQL LDQV VRR++ SR SF M+TP NN++IDVE+G+ KD EKA+RS++ + + Sbjct: 33 NHQLNSLLDQVSSPVRRDLVSRASFGMRTPGNNDEIDVESGRIEKDREKAVRSKKGIALY 92 Query: 49 NPALLSGLAYCFSSCS 2 N ALLSGLAYCFSSCS Sbjct: 93 NQALLSGLAYCFSSCS 108 >ref|XP_011090177.1| GDP-mannose transporter GONST1 isoform X1 [Sesamum indicum] Length = 399 Score = 89.0 bits (219), Expect = 2e-17 Identities = 47/75 (62%), Positives = 55/75 (73%), Gaps = 1/75 (1%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASRS-FRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVR 50 NHQ +DQV VRREIASRS MKTPNNN+ DVE+G+ K+ EKA RS+R L++ Sbjct: 40 NHQFNAFVDQVSSPVRREIASRSSLGMKTPNNNDQTDVESGRLEKEREKATRSKRGLSLH 99 Query: 49 NPALLSGLAYCFSSC 5 N A LSGLAYCFSSC Sbjct: 100 NKAFLSGLAYCFSSC 114 >ref|XP_012838445.1| PREDICTED: GDP-mannose transporter GONST1-like [Erythranthe guttata] Length = 373 Score = 84.3 bits (207), Expect = 6e-16 Identities = 44/76 (57%), Positives = 56/76 (73%), Gaps = 1/76 (1%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASRSFR-MKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVR 50 NHQ +DQV RREIA+RS MK P+++ +IDVE+G+ KD EK++RS+R LT+ Sbjct: 12 NHQFTTSVDQVSSPARREIANRSLSGMKFPSDSEEIDVESGRLDKDREKSVRSKRGLTLH 71 Query: 49 NPALLSGLAYCFSSCS 2 N ALLSGLAYC SSCS Sbjct: 72 NQALLSGLAYCLSSCS 87 >ref|XP_022898345.1| GDP-mannose transporter GONST1-like isoform X1 [Olea europaea var. sylvestris] Length = 381 Score = 80.9 bits (198), Expect = 1e-14 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 2/77 (2%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASRS-FRMKTPNNNNDIDVETGKSGKDIEKAMRS-RRILTV 53 +HQL G DQV VRRE+ SRS M TPNN ++IDVE+GK + EK + S +R+L + Sbjct: 18 SHQLNGLPDQVSSPVRREVVSRSALVMSTPNNYDEIDVESGKCEEGREKPVHSSKRVLRI 77 Query: 52 RNPALLSGLAYCFSSCS 2 N ALL+GLAYCFSSCS Sbjct: 78 HNQALLAGLAYCFSSCS 94 >ref|XP_022897972.1| GDP-mannose transporter GONST1-like isoform X2 [Olea europaea var. sylvestris] Length = 350 Score = 80.1 bits (196), Expect = 2e-14 Identities = 43/77 (55%), Positives = 56/77 (72%), Gaps = 2/77 (2%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASRS-FRMKTPNNNNDIDVETGKSGKDIEKAMRS-RRILTV 53 +HQL G D+V VRRE+ SRS M TP+N ++IDVE+GK + EK +RS +R+L + Sbjct: 18 SHQLNGLPDEVSSPVRREVVSRSALGMNTPSNYDEIDVESGKLEEGREKTVRSSKRVLRI 77 Query: 52 RNPALLSGLAYCFSSCS 2 N ALL+GLAYCFSSCS Sbjct: 78 HNQALLAGLAYCFSSCS 94 >ref|XP_022897970.1| GDP-mannose transporter GONST1-like isoform X1 [Olea europaea var. sylvestris] Length = 383 Score = 80.1 bits (196), Expect = 2e-14 Identities = 43/77 (55%), Positives = 56/77 (72%), Gaps = 2/77 (2%) Frame = -3 Query: 226 NHQLQGQLDQVPGLVRREIASRS-FRMKTPNNNNDIDVETGKSGKDIEKAMRS-RRILTV 53 +HQL G D+V VRRE+ SRS M TP+N ++IDVE+GK + EK +RS +R+L + Sbjct: 18 SHQLNGLPDEVSSPVRREVVSRSALGMNTPSNYDEIDVESGKLEEGREKTVRSSKRVLRI 77 Query: 52 RNPALLSGLAYCFSSCS 2 N ALL+GLAYCFSSCS Sbjct: 78 HNQALLAGLAYCFSSCS 94 >ref|XP_020550138.1| GDP-mannose transporter GONST1-like isoform X2 [Sesamum indicum] Length = 276 Score = 79.0 bits (193), Expect = 2e-14 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = -3 Query: 172 IASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGLAYCFSSCS 2 +ASRSF +K P N++++DVE G++ KD KA RS+R+LT+ N ALLSGLAYCFSSCS Sbjct: 1 MASRSFGVKIPGNHDEVDVEAGRTEKDRGKAFRSKRVLTIHNQALLSGLAYCFSSCS 57 >ref|XP_011080450.1| GDP-mannose transporter GONST1-like isoform X1 [Sesamum indicum] Length = 341 Score = 79.0 bits (193), Expect = 4e-14 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = -3 Query: 172 IASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGLAYCFSSCS 2 +ASRSF +K P N++++DVE G++ KD KA RS+R+LT+ N ALLSGLAYCFSSCS Sbjct: 1 MASRSFGVKIPGNHDEVDVEAGRTEKDRGKAFRSKRVLTIHNQALLSGLAYCFSSCS 57 >ref|XP_021636726.1| GDP-mannose transporter GONST1-like isoform X1 [Hevea brasiliensis] ref|XP_021636727.1| GDP-mannose transporter GONST1-like isoform X1 [Hevea brasiliensis] ref|XP_021636728.1| GDP-mannose transporter GONST1-like isoform X1 [Hevea brasiliensis] Length = 378 Score = 76.3 bits (186), Expect = 5e-13 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 1/75 (1%) Frame = -3 Query: 223 HQLQGQLDQVPGLVRREIASRS-FRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRN 47 H+L G +DQ +R+EI +RS F MK+ + N++ID+E GK KD +K RS R++ ++N Sbjct: 18 HELNGIVDQTTSPIRKEIVNRSSFAMKS-HENDEIDLEDGKLEKDRDKTARSNRVIKIQN 76 Query: 46 PALLSGLAYCFSSCS 2 ALLSGLAYC SSCS Sbjct: 77 QALLSGLAYCISSCS 91 >gb|PHU03127.1| GDP-mannose transporter GONST1, partial [Capsicum chinense] Length = 334 Score = 75.1 bits (183), Expect = 1e-12 Identities = 37/68 (54%), Positives = 49/68 (72%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD++ RRE+ +RSF MK N N++ D+E G S KD EK++RS + +TV N ALLSG+ Sbjct: 12 LDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSGV 70 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 71 AYCISSCS 78 >gb|PHT68540.1| GDP-mannose transporter GONST1, partial [Capsicum annuum] Length = 399 Score = 75.1 bits (183), Expect = 1e-12 Identities = 37/68 (54%), Positives = 49/68 (72%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD++ RRE+ +RSF MK N N++ D+E G S KD EK++RS + +TV N ALLSG+ Sbjct: 42 LDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSGV 100 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 101 AYCISSCS 108 >ref|XP_016542725.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Capsicum annuum] Length = 402 Score = 75.1 bits (183), Expect = 1e-12 Identities = 37/68 (54%), Positives = 49/68 (72%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD++ RRE+ +RSF MK N N++ D+E G S KD EK++RS + +TV N ALLSG+ Sbjct: 45 LDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSGV 103 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 104 AYCISSCS 111 >ref|XP_016542724.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Capsicum annuum] Length = 403 Score = 75.1 bits (183), Expect = 1e-12 Identities = 37/68 (54%), Positives = 49/68 (72%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD++ RRE+ +RSF MK N N++ D+E G S KD EK++RS + +TV N ALLSG+ Sbjct: 46 LDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSGV 104 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 105 AYCISSCS 112 >ref|XP_016441323.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Nicotiana tabacum] Length = 401 Score = 74.7 bits (182), Expect = 2e-12 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD V RRE+ +RSF MK N N++ D+E G KD EK++RS +++TV N ALLSG+ Sbjct: 46 LDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSGV 104 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 105 AYCISSCS 112 >ref|XP_009760359.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Nicotiana sylvestris] Length = 401 Score = 74.7 bits (182), Expect = 2e-12 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD V RRE+ +RSF MK N N++ D+E G KD EK++RS +++TV N ALLSG+ Sbjct: 46 LDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSGV 104 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 105 AYCISSCS 112 >ref|XP_016441322.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Nicotiana tabacum] Length = 402 Score = 74.7 bits (182), Expect = 2e-12 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD V RRE+ +RSF MK N N++ D+E G KD EK++RS +++TV N ALLSG+ Sbjct: 47 LDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSGV 105 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 106 AYCISSCS 113 >ref|XP_009760358.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Nicotiana sylvestris] Length = 402 Score = 74.7 bits (182), Expect = 2e-12 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -3 Query: 205 LDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGL 26 LD V RRE+ +RSF MK N N++ D+E G KD EK++RS +++TV N ALLSG+ Sbjct: 47 LDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSGV 105 Query: 25 AYCFSSCS 2 AYC SSCS Sbjct: 106 AYCISSCS 113 >ref|XP_010649370.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Vitis vinifera] Length = 380 Score = 74.3 bits (181), Expect = 2e-12 Identities = 36/74 (48%), Positives = 48/74 (64%) Frame = -3 Query: 223 HQLQGQLDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNP 44 H+ G LDQV +RRE+ +RS P + + D+E GK KD EK++RS R++ + N Sbjct: 18 HETNGVLDQVSSPLRREVLNRSVFSMKPLGSEETDLEDGKLEKDREKSVRSNRVVRIHNQ 77 Query: 43 ALLSGLAYCFSSCS 2 ALLSG AYC SSCS Sbjct: 78 ALLSGFAYCISSCS 91 >emb|CBI37536.3| unnamed protein product, partial [Vitis vinifera] Length = 648 Score = 74.3 bits (181), Expect = 3e-12 Identities = 36/74 (48%), Positives = 48/74 (64%) Frame = -3 Query: 223 HQLQGQLDQVPGLVRREIASRSFRMKTPNNNNDIDVETGKSGKDIEKAMRSRRILTVRNP 44 H+ G LDQV +RRE+ +RS P + + D+E GK KD EK++RS R++ + N Sbjct: 286 HETNGVLDQVSSPLRREVLNRSVFSMKPLGSEETDLEDGKLEKDREKSVRSNRVVRIHNQ 345 Query: 43 ALLSGLAYCFSSCS 2 ALLSG AYC SSCS Sbjct: 346 ALLSGFAYCISSCS 359