BLASTX nr result
ID: Rehmannia30_contig00025629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025629 (689 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831203.1| PREDICTED: kinectin-like [Erythranthe guttata] 96 4e-19 ref|XP_011080049.1| rootletin [Sesamum indicum] 79 5e-13 >ref|XP_012831203.1| PREDICTED: kinectin-like [Erythranthe guttata] Length = 1000 Score = 96.3 bits (238), Expect = 4e-19 Identities = 64/140 (45%), Positives = 79/140 (56%), Gaps = 8/140 (5%) Frame = +1 Query: 1 NEIADLRLAIEHIIKYGLESEYSPDGLTARIKQLERNRASLRNGTPLSTD---VRKQEKS 171 +EIADLRLAI HIIKYGLESEYSP LT+R KQLE +A L+ TP S+ R +EK Sbjct: 860 SEIADLRLAIAHIIKYGLESEYSPYRLTSRTKQLETEQARLKKRTPASSSSGYARNREKG 919 Query: 172 RRFAQPEDSNKRMKQEKQHEPLLQHEQEIKSPPRLNKLVNEAAMPHPSKRRRTNISWH-- 345 +RF Q D KR QE+QH+ + E + V A +KR+RTN + Sbjct: 920 KRFNQSHDEKKRKLQEQQHD---EPNTEARFCRSQTNEVPTALHGKANKRQRTNNLPYRG 976 Query: 346 --EVEGVR-HLRSPPERHRL 396 EGVR H R PP H + Sbjct: 977 PLHQEGVRHHARPPPPEHHV 996 >ref|XP_011080049.1| rootletin [Sesamum indicum] Length = 1010 Score = 78.6 bits (192), Expect = 5e-13 Identities = 54/137 (39%), Positives = 77/137 (56%), Gaps = 1/137 (0%) Frame = +1 Query: 1 NEIADLRLAIEHIIKYGLESEYSPDGLTARIKQLERNRASLRN-GTPLSTDVRKQEKSRR 177 +EI DLR AIEHIIKYGLE EYS D LT RI QLE++R ++N S++ RKQE ++R Sbjct: 845 SEIKDLRYAIEHIIKYGLEYEYSVDTLTLRINQLEKDREGMKNRRLSSSSNPRKQESNKR 904 Query: 178 FAQPEDSNKRMKQEKQHEPLLQHEQEIKSPPRLNKLVNEAAMPHPSKRRRTNISWHEVEG 357 P +NK Q++QHE +E+ P+ A +P + ++++W Sbjct: 905 ---PAHANKSKAQQRQHEA----TREVHRVPK-------AQVPEQGSEKGSHLAWKS--- 947 Query: 358 VRHLRSPPERHRLRH*T 408 RH +S + R RH T Sbjct: 948 -RHWQS---KTRKRHAT 960