BLASTX nr result
ID: Rehmannia30_contig00025483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025483 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN04680.1| 1, 2-alpha-mannosidase [Handroanthus impetiginosus] 60 3e-07 ref|XP_011096552.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 59 7e-07 ref|XP_012842222.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 57 4e-06 gb|KZV21392.1| hypothetical protein F511_18558 [Dorcoceras hygro... 57 4e-06 >gb|PIN04680.1| 1, 2-alpha-mannosidase [Handroanthus impetiginosus] Length = 630 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 537 LYLLFGDRNVLPFNEYVFNTEAHPLPIRATAGRK 436 LYLLFGDR+V+P +EYVFNTEAHP PIR AG K Sbjct: 597 LYLLFGDRDVIPLDEYVFNTEAHPFPIRGNAGTK 630 >ref|XP_011096552.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Sesamum indicum] Length = 631 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 537 LYLLFGDRNVLPFNEYVFNTEAHPLPIRATAGRK 436 LYLLFGDRN +P ++YVFNTEAHPLPI+ AG K Sbjct: 598 LYLLFGDRNAIPLDKYVFNTEAHPLPIQGNAGTK 631 >ref|XP_012842222.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Erythranthe guttata] gb|EYU33358.1| hypothetical protein MIMGU_mgv1a002872mg [Erythranthe guttata] Length = 629 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 537 LYLLFGDRNVLPFNEYVFNTEAHPLPIRATAGR 439 LYLLFGDRNV+P ++YVFNTEAHP PIR A R Sbjct: 596 LYLLFGDRNVIPLDKYVFNTEAHPFPIRDNAVR 628 >gb|KZV21392.1| hypothetical protein F511_18558 [Dorcoceras hygrometricum] Length = 632 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 537 LYLLFGDRNVLPFNEYVFNTEAHPLPIRATAGRK 436 LYLLFGD N +P +EYVFNTEAHP+PI+ TA K Sbjct: 599 LYLLFGDSNAIPLDEYVFNTEAHPIPIQRTASMK 632