BLASTX nr result
ID: Rehmannia30_contig00025469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025469 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPD71809.1| hypothetical protein GOBAR_DD31290 [Gossypium bar... 57 5e-06 >gb|PPD71809.1| hypothetical protein GOBAR_DD31290 [Gossypium barbadense] Length = 391 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -2 Query: 154 CKEFTLMDKNLNAGHVRPS--IHFILDTISFSWAPNMLYCDISSFQPMEIYVD 2 CK+F L + R + IHF LD+I PNM+YCDISSFQPMEIYVD Sbjct: 157 CKKFMQDANGLESQFKRSASKIHFALDSICLKKLPNMIYCDISSFQPMEIYVD 209