BLASTX nr result
ID: Rehmannia30_contig00025407
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025407 (1383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB95709.1| hypothetical protein L484_007459 [Morus notabilis] 62 1e-06 ref|XP_024025868.1| heparan-alpha-glucosaminide N-acetyltransfer... 62 1e-06 ref|XP_012834006.1| PREDICTED: heparan-alpha-glucosaminide N-ace... 60 8e-06 >gb|EXB95709.1| hypothetical protein L484_007459 [Morus notabilis] Length = 437 Score = 62.0 bits (149), Expect = 1e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 1249 FLISFYSVVNQVISDF*VHCSLRGSLEPPCNAVGFIDRILLGEKH 1383 F +S +V VHC +RGSLEPPCNAVGFIDRI+LGEKH Sbjct: 231 FAVSSLNVAGNTSDTQNVHCEMRGSLEPPCNAVGFIDRIILGEKH 275 >ref|XP_024025868.1| heparan-alpha-glucosaminide N-acetyltransferase [Morus notabilis] Length = 490 Score = 62.0 bits (149), Expect = 1e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 1249 FLISFYSVVNQVISDF*VHCSLRGSLEPPCNAVGFIDRILLGEKH 1383 F +S +V VHC +RGSLEPPCNAVGFIDRI+LGEKH Sbjct: 231 FAVSSLNVAGNTSDTQNVHCEMRGSLEPPCNAVGFIDRIILGEKH 275 >ref|XP_012834006.1| PREDICTED: heparan-alpha-glucosaminide N-acetyltransferase-like isoform X1 [Erythranthe guttata] gb|EYU46783.1| hypothetical protein MIMGU_mgv1a005462mg [Erythranthe guttata] Length = 483 Score = 59.7 bits (143), Expect = 8e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 1300 VHCSLRGSLEPPCNAVGFIDRILLGEKH 1383 VHC LRGSLEPPCNAVG IDRILLGEKH Sbjct: 241 VHCGLRGSLEPPCNAVGLIDRILLGEKH 268