BLASTX nr result
ID: Rehmannia30_contig00025330
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025330 (594 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841742.1| PREDICTED: uncharacterized protein LOC105962... 60 4e-07 ref|XP_020554488.1| uncharacterized protein LOC105176769 [Sesamu... 58 2e-06 gb|PIN24193.1| hypothetical protein CDL12_03079 [Handroanthus im... 57 3e-06 ref|XP_022886632.1| uncharacterized protein LOC111402501 isoform... 56 5e-06 ref|XP_022886630.1| uncharacterized protein LOC111402501 isoform... 56 8e-06 >ref|XP_012841742.1| PREDICTED: uncharacterized protein LOC105962022 [Erythranthe guttata] ref|XP_012841743.1| PREDICTED: uncharacterized protein LOC105962022 [Erythranthe guttata] ref|XP_012841744.1| PREDICTED: uncharacterized protein LOC105962022 [Erythranthe guttata] ref|XP_012841745.1| PREDICTED: uncharacterized protein LOC105962022 [Erythranthe guttata] gb|EYU33622.1| hypothetical protein MIMGU_mgv1a023477mg [Erythranthe guttata] Length = 390 Score = 60.1 bits (144), Expect = 4e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 473 LYLQTLHDAVFLYNTISSLSQREQGVKLNQEGFVVFEEYY 592 L Q L DAV LYNT+SSLSQ+EQ VKLNQEGF VF EYY Sbjct: 150 LVQQILLDAVLLYNTVSSLSQKEQTVKLNQEGFEVFREYY 189 >ref|XP_020554488.1| uncharacterized protein LOC105176769 [Sesamum indicum] Length = 379 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 473 LYLQTLHDAVFLYNTISSLSQREQGVKLNQEGFVVFEEYY 592 L Q L D+V LYNT+SSLSQ EQ VKLNQEGF VF EYY Sbjct: 150 LVQQMLLDSVLLYNTVSSLSQTEQTVKLNQEGFEVFREYY 189 >gb|PIN24193.1| hypothetical protein CDL12_03079 [Handroanthus impetiginosus] Length = 378 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +2 Query: 473 LYLQTLHDAVFLYNTISSLSQREQGVKLNQEGFVVFEEYY 592 L Q L DAV +YNT+SSLSQREQ V+LNQ+GF VF EYY Sbjct: 150 LVQQILLDAVVVYNTVSSLSQREQTVRLNQDGFEVFREYY 189 >ref|XP_022886632.1| uncharacterized protein LOC111402501 isoform X2 [Olea europaea var. sylvestris] Length = 264 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 473 LYLQTLHDAVFLYNTISSLSQREQGVKLNQEGFVVFEEYY 592 L Q L DAV+++NT+SS+SQ+EQ +KLNQ+GF VF EYY Sbjct: 150 LVQQVLLDAVYVFNTVSSISQKEQTIKLNQKGFEVFREYY 189 >ref|XP_022886630.1| uncharacterized protein LOC111402501 isoform X1 [Olea europaea var. sylvestris] ref|XP_022886631.1| uncharacterized protein LOC111402501 isoform X1 [Olea europaea var. sylvestris] Length = 408 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 473 LYLQTLHDAVFLYNTISSLSQREQGVKLNQEGFVVFEEYY 592 L Q L DAV+++NT+SS+SQ+EQ +KLNQ+GF VF EYY Sbjct: 150 LVQQVLLDAVYVFNTVSSISQKEQTIKLNQKGFEVFREYY 189