BLASTX nr result
ID: Rehmannia30_contig00025292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025292 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25755.1| hypothetical protein MIMGU_mgv1a026540mg [Erythra... 69 2e-10 ref|XP_012851341.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-10 ref|XP_011094045.1| pentatricopeptide repeat-containing protein ... 68 2e-10 ref|XP_011094044.1| pentatricopeptide repeat-containing protein ... 68 2e-10 gb|PIN07100.1| hypothetical protein CDL12_20334 [Handroanthus im... 64 4e-09 ref|XP_022883048.1| pentatricopeptide repeat-containing protein ... 59 3e-07 ref|XP_022883047.1| pentatricopeptide repeat-containing protein ... 59 3e-07 ref|XP_010425791.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_010496527.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_019245719.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_009618439.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_009779068.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_013668942.1| pentatricopeptide repeat-containing protein ... 54 3e-06 gb|AAK55667.1|AF378864_1 AT3g42630/T12K4_80 [Arabidopsis thalian... 55 7e-06 ref|XP_012083449.1| pentatricopeptide repeat-containing protein ... 55 7e-06 emb|CAB86446.1| putative protein [Arabidopsis thaliana] 55 8e-06 ref|NP_566863.2| Pentatricopeptide repeat (PPR) superfamily prot... 55 8e-06 ref|XP_020882248.1| pentatricopeptide repeat-containing protein ... 55 8e-06 ref|XP_020538397.1| pentatricopeptide repeat-containing protein ... 55 8e-06 ref|XP_024009736.1| pentatricopeptide repeat-containing protein ... 55 1e-05 >gb|EYU25755.1| hypothetical protein MIMGU_mgv1a026540mg [Erythranthe guttata] Length = 400 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 VMEYVK+K+WTYKMLIS+YLKKK RSNQIFWNY Sbjct: 368 VMEYVKRKDWTYKMLISVYLKKKFRSNQIFWNY 400 >ref|XP_012851341.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Erythranthe guttata] Length = 411 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 VMEYVK+K+WTYKMLIS+YLKKK RSNQIFWNY Sbjct: 379 VMEYVKRKDWTYKMLISVYLKKKFRSNQIFWNY 411 >ref|XP_011094045.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Sesamum indicum] Length = 419 Score = 68.2 bits (165), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 VMEYVKKK+WTYKM+I+IYLKKK RSNQIFWNY Sbjct: 387 VMEYVKKKDWTYKMIIAIYLKKKFRSNQIFWNY 419 >ref|XP_011094044.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Sesamum indicum] Length = 420 Score = 68.2 bits (165), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 VMEYVKKK+WTYKM+I+IYLKKK RSNQIFWNY Sbjct: 388 VMEYVKKKDWTYKMIIAIYLKKKFRSNQIFWNY 420 >gb|PIN07100.1| hypothetical protein CDL12_20334 [Handroanthus impetiginosus] Length = 347 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+EY KK+WTYKMLI+IYLKKK+RSNQIFWNY Sbjct: 315 VLEYAGKKDWTYKMLIAIYLKKKLRSNQIFWNY 347 >ref|XP_022883048.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Olea europaea var. sylvestris] Length = 402 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +EY +KK WTY MLI+ YLKKK RSNQIFWNY Sbjct: 371 LEYTRKKKWTYNMLITTYLKKKFRSNQIFWNY 402 >ref|XP_022883047.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Olea europaea var. sylvestris] Length = 442 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +EY +KK WTY MLI+ YLKKK RSNQIFWNY Sbjct: 411 LEYTRKKKWTYNMLITTYLKKKFRSNQIFWNY 442 >ref|XP_010425791.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Camelina sativa] Length = 421 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +KNWTY+MLI +YLKKK+R +QIFWNY Sbjct: 389 VLEFSPRKNWTYRMLIGVYLKKKLRRDQIFWNY 421 >ref|XP_010496527.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Camelina sativa] Length = 422 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +KNWTY+MLI +YLKKK+R +QIFWNY Sbjct: 390 VLEFSPRKNWTYRMLIGVYLKKKLRRDQIFWNY 422 >ref|XP_019245719.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana attenuata] ref|XP_019245720.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana attenuata] gb|OIT03400.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 414 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +E+ KKKNWTY+ LI+IYLKK +R NQIFWNY Sbjct: 383 LEFSKKKNWTYEELITIYLKKYVRRNQIFWNY 414 >ref|XP_009618439.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana tomentosiformis] ref|XP_016502620.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Nicotiana tabacum] Length = 414 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +E+ KKKNWTY+ LI+IYLKK +R NQIFWNY Sbjct: 383 LEFSKKKNWTYEELITIYLKKYVRRNQIFWNY 414 >ref|XP_009779068.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana sylvestris] ref|XP_009779075.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana sylvestris] ref|XP_009779083.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana sylvestris] ref|XP_009779092.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Nicotiana sylvestris] ref|XP_016458139.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Nicotiana tabacum] ref|XP_016458140.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Nicotiana tabacum] ref|XP_016458141.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Nicotiana tabacum] ref|XP_016458142.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Nicotiana tabacum] Length = 414 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +E+ KKKNWTY+ LI+IYLKK +R NQIFWNY Sbjct: 383 LEFSKKKNWTYEELITIYLKKCVRRNQIFWNY 414 >ref|XP_013668942.1| pentatricopeptide repeat-containing protein At3g42630-like [Brassica napus] Length = 158 Score = 54.3 bits (129), Expect = 3e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +++NWTY+ LI +YLKKK+R +QIFWNY Sbjct: 126 VLEFGQRRNWTYRKLIGVYLKKKLRRDQIFWNY 158 >gb|AAK55667.1|AF378864_1 AT3g42630/T12K4_80 [Arabidopsis thaliana] gb|AAL15373.1| AT3g42630/T12K4_80 [Arabidopsis thaliana] Length = 327 Score = 55.1 bits (131), Expect = 7e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +KNWTY+ LI +YLKKK+R +QIFWNY Sbjct: 295 VLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 327 >ref|XP_012083449.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Jatropha curcas] ref|XP_020538398.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Jatropha curcas] Length = 354 Score = 55.1 bits (131), Expect = 7e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +E+ +KK WTYK L+S+YL+K+ RSNQIFWNY Sbjct: 323 LEFKRKKKWTYKELVSLYLRKQYRSNQIFWNY 354 >emb|CAB86446.1| putative protein [Arabidopsis thaliana] Length = 412 Score = 55.1 bits (131), Expect = 8e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +KNWTY+ LI +YLKKK+R +QIFWNY Sbjct: 380 VLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 412 >ref|NP_566863.2| Pentatricopeptide repeat (PPR) superfamily protein [Arabidopsis thaliana] sp|Q9M2A1.2|PP263_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g42630 gb|AEE77742.1| Pentatricopeptide repeat (PPR) superfamily protein [Arabidopsis thaliana] gb|OAP05959.1| hypothetical protein AXX17_AT3G35570 [Arabidopsis thaliana] Length = 415 Score = 55.1 bits (131), Expect = 8e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +KNWTY+ LI +YLKKK+R +QIFWNY Sbjct: 383 VLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 415 >ref|XP_020882248.1| pentatricopeptide repeat-containing protein At3g42630 [Arabidopsis lyrata subsp. lyrata] gb|EFH51839.1| pentatricopeptide repeat protein [Arabidopsis lyrata subsp. lyrata] Length = 419 Score = 55.1 bits (131), Expect = 8e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ +KNWTY+ LI +YLKKK+R +QIFWNY Sbjct: 387 VLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 419 >ref|XP_020538397.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Jatropha curcas] gb|KDP28668.1| hypothetical protein JCGZ_14439 [Jatropha curcas] Length = 429 Score = 55.1 bits (131), Expect = 8e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +2 Query: 5 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 +E+ +KK WTYK L+S+YL+K+ RSNQIFWNY Sbjct: 398 LEFKRKKKWTYKELVSLYLRKQYRSNQIFWNY 429 >ref|XP_024009736.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Eutrema salsugineum] Length = 343 Score = 54.7 bits (130), Expect = 1e-05 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 100 V+E+ ++KNWTY+ LI +YLKKK R +QIFWNY Sbjct: 311 VLEFGQRKNWTYRKLIGVYLKKKFRRDQIFWNY 343