BLASTX nr result
ID: Rehmannia30_contig00025283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025283 (709 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844155.1| PREDICTED: uncharacterized protein LOC105964... 76 2e-12 ref|XP_011078618.1| uncharacterized protein LOC105162307 isoform... 74 1e-11 ref|XP_011078617.1| uncharacterized protein LOC105162307 isoform... 74 1e-11 gb|PIN11374.1| D-amino-acid oxidase [Handroanthus impetiginosus] 69 8e-10 ref|XP_022845362.1| uncharacterized protein LOC111368362 [Olea e... 59 1e-06 gb|KZV28377.1| hypothetical protein F511_16745 [Dorcoceras hygro... 59 1e-06 >ref|XP_012844155.1| PREDICTED: uncharacterized protein LOC105964176 [Erythranthe guttata] gb|EYU31797.1| hypothetical protein MIMGU_mgv1a006407mg [Erythranthe guttata] Length = 445 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/49 (77%), Positives = 41/49 (83%), Gaps = 4/49 (8%) Frame = +2 Query: 2 VKLLWRGAECWKESLNLLNIAERA----LVNEGKGETLENGESPIIRRR 136 VKLLWRGAECW ESLNL+NIAE A LVNEGK ET +NGESPI+RRR Sbjct: 105 VKLLWRGAECWNESLNLINIAEEALLNKLVNEGKFETPKNGESPIVRRR 153 >ref|XP_011078618.1| uncharacterized protein LOC105162307 isoform X2 [Sesamum indicum] Length = 412 Score = 74.3 bits (181), Expect = 1e-11 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 3/48 (6%) Frame = +2 Query: 2 VKLLWRGAECWKESLNLLNIAERA---LVNEGKGETLENGESPIIRRR 136 VKLLWRGAECW E+LNLL+IAE A LVN+GK ETLEN ESPI+RRR Sbjct: 67 VKLLWRGAECWNETLNLLHIAEGALLKLVNQGKCETLENNESPIVRRR 114 >ref|XP_011078617.1| uncharacterized protein LOC105162307 isoform X1 [Sesamum indicum] Length = 461 Score = 74.3 bits (181), Expect = 1e-11 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 3/48 (6%) Frame = +2 Query: 2 VKLLWRGAECWKESLNLLNIAERA---LVNEGKGETLENGESPIIRRR 136 VKLLWRGAECW E+LNLL+IAE A LVN+GK ETLEN ESPI+RRR Sbjct: 116 VKLLWRGAECWNETLNLLHIAEGALLKLVNQGKCETLENNESPIVRRR 163 >gb|PIN11374.1| D-amino-acid oxidase [Handroanthus impetiginosus] Length = 459 Score = 68.9 bits (167), Expect = 8e-10 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 3/48 (6%) Frame = +2 Query: 2 VKLLWRGAECWKESLNLLNIAERALV---NEGKGETLENGESPIIRRR 136 VKLLW GAE WKESLNLLN+AE AL+ NEGK ETL N ESPI+RRR Sbjct: 114 VKLLWHGAEFWKESLNLLNVAEGALLKLANEGKCETLGNVESPIVRRR 161 >ref|XP_022845362.1| uncharacterized protein LOC111368362 [Olea europaea var. sylvestris] ref|XP_022845366.1| uncharacterized protein LOC111368369 [Olea europaea var. sylvestris] Length = 443 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 3/48 (6%) Frame = +2 Query: 2 VKLLWRGAECWKESLNLLNIAERA---LVNEGKGETLENGESPIIRRR 136 VKLLWRGAECWKESL+LLN+AE A LVN G ++ N E I+ RR Sbjct: 95 VKLLWRGAECWKESLDLLNVAEGALFKLVNGGNQDSPPNSEPSIVNRR 142 >gb|KZV28377.1| hypothetical protein F511_16745 [Dorcoceras hygrometricum] Length = 460 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = +2 Query: 5 KLLWRGAECWKESLNLLNIAERAL---VNEGKGETLENGESPIIRRR 136 KLLWRGAECWKESLNLLNIA+ A+ VN + ET + E+ I+RR+ Sbjct: 112 KLLWRGAECWKESLNLLNIAQDAILKKVNTAERETAQTCETQIVRRK 158