BLASTX nr result
ID: Rehmannia30_contig00025125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025125 (707 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019184983.1| PREDICTED: uncharacterized protein LOC109179... 65 6e-10 >ref|XP_019184983.1| PREDICTED: uncharacterized protein LOC109179963 [Ipomoea nil] Length = 156 Score = 64.7 bits (156), Expect(2) = 6e-10 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = +2 Query: 476 FSQIGSFWVCGTI--ISFIGDWWYLSCPHCPKKLKEAGEKLYCFGCDKFPE---NGNLRY 640 FS++GS+WV TI I IGDWWYLSC CP KL++A CF CDKF +GN Y Sbjct: 74 FSEVGSYWVLATILPIQTIGDWWYLSCKRCPIKLEQASN---CFYCDKFDNSYPDGNFWY 130 Score = 27.7 bits (60), Expect(2) = 6e-10 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 241 STPTCSISYRTMPSAQTVSEDLESGKSRVRTIEQLYSKREV 363 STP S++ + S+ T+ +++ + TIEQLY EV Sbjct: 37 STPKLSLNTPSRISSATLEDEINGDTLKTCTIEQLYDFSEV 77