BLASTX nr result
ID: Rehmannia30_contig00024787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00024787 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082138.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 163 7e-46 ref|XP_012837358.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 159 2e-44 gb|PIN13613.1| hypothetical protein CDL12_13760 [Handroanthus im... 158 8e-44 ref|XP_022868448.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 147 2e-40 ref|XP_022858892.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 148 3e-40 ref|XP_022868447.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 147 7e-40 ref|XP_022866887.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 147 1e-39 gb|KZV39866.1| F-box/FBD/LRR-repeat protein-like [Dorcoceras hyg... 146 2e-39 ref|XP_022871921.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 145 7e-39 gb|EPS64866.1| hypothetical protein M569_09913, partial [Genlise... 140 5e-38 gb|PIN14159.1| hypothetical protein CDL12_13216 [Handroanthus im... 135 5e-35 ref|XP_009594963.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 96 3e-20 ref|XP_009594958.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 96 3e-20 ref|XP_011074579.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 95 4e-20 ref|XP_016484325.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 94 5e-20 ref|XP_009776577.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 94 1e-19 gb|PHU28975.1| hypothetical protein BC332_01068 [Capsicum chinense] 90 1e-19 ref|XP_011074328.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 94 1e-19 ref|XP_016501805.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 93 2e-19 ref|XP_016501803.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 93 2e-19 >ref|XP_011082138.1| F-box/FBD/LRR-repeat protein At1g13570-like [Sesamum indicum] Length = 421 Score = 163 bits (413), Expect = 7e-46 Identities = 77/89 (86%), Positives = 82/89 (92%) Frame = +2 Query: 173 MKGNTVRSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFD 352 MKG + SE+D +TNLPNNII+NILGCLPLRDVVRTSILSREWRYKW SCP+IVFDFWFD Sbjct: 1 MKGAVI-SEADLLTNLPNNIIENILGCLPLRDVVRTSILSREWRYKWLSCPEIVFDFWFD 59 Query: 353 QMFLGGHKLEPLIYQILKQHKGPLLKFAL 439 QMFLG HKLEPLIYQILK HKGPLLKFAL Sbjct: 60 QMFLGDHKLEPLIYQILKLHKGPLLKFAL 88 >ref|XP_012837358.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Erythranthe guttata] gb|EYU37461.1| hypothetical protein MIMGU_mgv1a006943mg [Erythranthe guttata] Length = 425 Score = 159 bits (403), Expect = 2e-44 Identities = 72/81 (88%), Positives = 75/81 (92%) Frame = +2 Query: 197 ESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGGHK 376 +SDFI+NLPNNIIDNILGCLPLRD V TSILSREW YKW SCPDIVFDFWFDQMFLGGHK Sbjct: 10 DSDFISNLPNNIIDNILGCLPLRDAVSTSILSREWHYKWMSCPDIVFDFWFDQMFLGGHK 69 Query: 377 LEPLIYQILKQHKGPLLKFAL 439 LEPL+YQILK HKGPLLKF L Sbjct: 70 LEPLVYQILKLHKGPLLKFVL 90 >gb|PIN13613.1| hypothetical protein CDL12_13760 [Handroanthus impetiginosus] Length = 423 Score = 158 bits (399), Expect = 8e-44 Identities = 72/84 (85%), Positives = 78/84 (92%) Frame = +2 Query: 188 VRSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLG 367 VRS++D ITNLPNNII+NILGCLPLRDVVR SILSREWRYKW SCP+IVFDFWFDQMFLG Sbjct: 5 VRSDADLITNLPNNIIENILGCLPLRDVVRMSILSREWRYKWMSCPEIVFDFWFDQMFLG 64 Query: 368 GHKLEPLIYQILKQHKGPLLKFAL 439 H LEPLIYQIL+ HKGPLL+FAL Sbjct: 65 DHLLEPLIYQILRHHKGPLLRFAL 88 >ref|XP_022868448.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Olea europaea var. sylvestris] Length = 346 Score = 147 bits (372), Expect = 2e-40 Identities = 65/83 (78%), Positives = 76/83 (91%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RSE+D I+NLP +II+NILGCLPLRDVVRTSILSREWRYKW +CP++VFDFWFDQMFLG Sbjct: 5 RSEADLISNLPGSIIENILGCLPLRDVVRTSILSREWRYKWVTCPELVFDFWFDQMFLGN 64 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 HKLE L+Y IL+ H+GPL+KFAL Sbjct: 65 HKLEKLVYPILELHQGPLIKFAL 87 >ref|XP_022858892.1| F-box/FBD/LRR-repeat protein At1g13570-like [Olea europaea var. sylvestris] Length = 413 Score = 148 bits (374), Expect = 3e-40 Identities = 65/83 (78%), Positives = 75/83 (90%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RSE+D I+NLP +IIDNI+GCLPLRD VRTSILSREWRYKW +CP++VFDFWFDQMFLG Sbjct: 5 RSEADLISNLPGSIIDNIMGCLPLRDAVRTSILSREWRYKWVTCPELVFDFWFDQMFLGN 64 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 HKLE L+Y ILK H+GPL+KFAL Sbjct: 65 HKLEQLVYPILKLHRGPLVKFAL 87 >ref|XP_022868447.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Olea europaea var. sylvestris] Length = 415 Score = 147 bits (372), Expect = 7e-40 Identities = 65/83 (78%), Positives = 76/83 (91%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RSE+D I+NLP +II+NILGCLPLRDVVRTSILSREWRYKW +CP++VFDFWFDQMFLG Sbjct: 5 RSEADLISNLPGSIIENILGCLPLRDVVRTSILSREWRYKWVTCPELVFDFWFDQMFLGN 64 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 HKLE L+Y IL+ H+GPL+KFAL Sbjct: 65 HKLEKLVYPILELHQGPLIKFAL 87 >ref|XP_022866887.1| F-box/FBD/LRR-repeat protein At1g13570-like [Olea europaea var. sylvestris] Length = 418 Score = 147 bits (371), Expect = 1e-39 Identities = 66/83 (79%), Positives = 76/83 (91%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RSE+D I+NLP +II+NILGCLPLRD VRTSILSREWRYKW +CP++VFDFWFDQMFLG Sbjct: 6 RSEADLISNLPCSIIENILGCLPLRDAVRTSILSREWRYKWITCPELVFDFWFDQMFLGN 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 HKLE +IYQIL+ H+GPLLKFAL Sbjct: 66 HKLEMIIYQILRLHQGPLLKFAL 88 >gb|KZV39866.1| F-box/FBD/LRR-repeat protein-like [Dorcoceras hygrometricum] Length = 418 Score = 146 bits (369), Expect = 2e-39 Identities = 68/91 (74%), Positives = 82/91 (90%) Frame = +2 Query: 167 VRMKGNTVRSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFW 346 +RMK + + SE D I++LP +II+NILGCLPLRD+VRTSILSREWRYKW +CP+IVFDFW Sbjct: 1 MRMKVSLM-SEVDLISDLPCSIIENILGCLPLRDIVRTSILSREWRYKWITCPEIVFDFW 59 Query: 347 FDQMFLGGHKLEPLIYQILKQHKGPLLKFAL 439 FDQMFLGGHKLE L++QILK H+GPLL+FAL Sbjct: 60 FDQMFLGGHKLETLVHQILKLHRGPLLRFAL 90 >ref|XP_022871921.1| F-box/FBD/LRR-repeat protein At1g13570-like [Olea europaea var. sylvestris] Length = 416 Score = 145 bits (365), Expect = 7e-39 Identities = 65/83 (78%), Positives = 74/83 (89%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 +SE+D I+NLP +II+NILGCLPLRD VRTSILSREWRYKW +CP +VFDFWFDQMFLG Sbjct: 6 KSEADLISNLPGSIIENILGCLPLRDAVRTSILSREWRYKWVTCPYLVFDFWFDQMFLGN 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 HKLE L+Y ILK H+GPLLKFAL Sbjct: 66 HKLETLVYTILKFHQGPLLKFAL 88 >gb|EPS64866.1| hypothetical protein M569_09913, partial [Genlisea aurea] Length = 314 Score = 140 bits (353), Expect = 5e-38 Identities = 63/80 (78%), Positives = 69/80 (86%) Frame = +2 Query: 200 SDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGGHKL 379 +D TNLP NII+NI G LPLRD VRTS+LSREWRYKW + PDIV DFWFDQMFLGGHKL Sbjct: 1 TDSFTNLPTNIIENIFGFLPLRDTVRTSVLSREWRYKWMTSPDIVLDFWFDQMFLGGHKL 60 Query: 380 EPLIYQILKQHKGPLLKFAL 439 EPL+YQILK HKGPLL+F L Sbjct: 61 EPLVYQILKLHKGPLLRFVL 80 >gb|PIN14159.1| hypothetical protein CDL12_13216 [Handroanthus impetiginosus] Length = 442 Score = 135 bits (340), Expect = 5e-35 Identities = 60/79 (75%), Positives = 69/79 (87%) Frame = +2 Query: 203 DFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGGHKLE 382 D I+NLP II+NILG LPLRD+VRTSILSREW YKW +CP++VFDFWFDQMFL GHKLE Sbjct: 33 DLISNLPCTIIENILGYLPLRDIVRTSILSREWTYKWLTCPELVFDFWFDQMFLKGHKLE 92 Query: 383 PLIYQILKQHKGPLLKFAL 439 PLIY IL+ H+GPLLKF + Sbjct: 93 PLIYDILRHHQGPLLKFVV 111 >ref|XP_009594963.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Nicotiana tomentosiformis] Length = 421 Score = 95.5 bits (236), Expect = 3e-20 Identities = 43/83 (51%), Positives = 60/83 (72%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RS+ D I+NLP N++D ILGCLPL+D V+TSILS++WRYKW + ++ F + F F Sbjct: 6 RSDVDTISNLPCNVVDEILGCLPLKDAVKTSILSKDWRYKWVTRQELDFGYNFFGSFAHD 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L HKGP+LKF L Sbjct: 66 QEAKTIIYQVLLIHKGPILKFKL 88 >ref|XP_009594958.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Nicotiana tomentosiformis] ref|XP_009594959.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Nicotiana tomentosiformis] ref|XP_009594960.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Nicotiana tomentosiformis] ref|XP_018624706.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Nicotiana tomentosiformis] Length = 422 Score = 95.5 bits (236), Expect = 3e-20 Identities = 43/83 (51%), Positives = 60/83 (72%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RS+ D I+NLP N++D ILGCLPL+D V+TSILS++WRYKW + ++ F + F F Sbjct: 6 RSDVDTISNLPCNVVDEILGCLPLKDAVKTSILSKDWRYKWVTRQELDFGYNFFGSFAHD 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L HKGP+LKF L Sbjct: 66 QEAKTIIYQVLLIHKGPILKFKL 88 >ref|XP_011074579.1| F-box/FBD/LRR-repeat protein At1g13570-like [Sesamum indicum] Length = 419 Score = 95.1 bits (235), Expect = 4e-20 Identities = 48/80 (60%), Positives = 59/80 (73%) Frame = +2 Query: 200 SDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGGHKL 379 SD I+NLP +IIDNIL LPLR+VVRTSILSR WR KW S P +VF+ F + + + Sbjct: 12 SDRISNLPCDIIDNILKYLPLREVVRTSILSRGWRCKWVSIPYLVFNEIFQESLPEEYDI 71 Query: 380 EPLIYQILKQHKGPLLKFAL 439 EP+IYQIL HKGP++KF L Sbjct: 72 EPIIYQILLLHKGPIIKFIL 91 >ref|XP_016484325.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana tabacum] ref|XP_016484326.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana tabacum] ref|XP_016484327.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana tabacum] ref|XP_016484328.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana tabacum] Length = 344 Score = 94.0 bits (232), Expect = 5e-20 Identities = 43/83 (51%), Positives = 59/83 (71%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RS+ D I+NLP N++D ILGCLPL+D V+TSILS+ WRYKW + ++ F + F F Sbjct: 6 RSDVDTISNLPCNVLDEILGCLPLKDAVKTSILSKHWRYKWATRQELDFGYDFFGSFAHY 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L HKGP+LKF L Sbjct: 66 QEAKTIIYQVLLLHKGPILKFKL 88 >ref|XP_009776577.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] ref|XP_009776578.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] ref|XP_009776579.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] ref|XP_009776580.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] Length = 410 Score = 94.0 bits (232), Expect = 1e-19 Identities = 43/83 (51%), Positives = 59/83 (71%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RS+ D I+NLP N++D ILGCLPL+D V+TSILS+ WRYKW + ++ F + F F Sbjct: 6 RSDVDTISNLPCNVLDEILGCLPLKDAVKTSILSKHWRYKWATRQELDFGYDFFGSFAHY 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L HKGP+LKF L Sbjct: 66 QEAKTIIYQVLLLHKGPILKFKL 88 >gb|PHU28975.1| hypothetical protein BC332_01068 [Capsicum chinense] Length = 202 Score = 90.1 bits (222), Expect = 1e-19 Identities = 42/86 (48%), Positives = 58/86 (67%) Frame = +2 Query: 182 NTVRSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMF 361 N V + D I+NLP N++D ILGCLPL+D VRTSILS++WRYKW + ++ F F F Sbjct: 38 NYVTMKRDTISNLPCNVLDGILGCLPLKDAVRTSILSKDWRYKWVTRAELDFSGQFLTSF 97 Query: 362 LGGHKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L+ H+ PL KF L Sbjct: 98 NNSEEAKTIIYQVLRLHQEPLPKFTL 123 >ref|XP_011074328.1| F-box/FBD/LRR-repeat protein At1g13570-like [Sesamum indicum] Length = 419 Score = 93.6 bits (231), Expect = 1e-19 Identities = 48/80 (60%), Positives = 58/80 (72%) Frame = +2 Query: 200 SDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGGHKL 379 SD I+NLP +IIDNIL LPLR+VVRTSILSR WR KW S P +VF+ F + + Sbjct: 12 SDRISNLPCDIIDNILKYLPLREVVRTSILSRGWRCKWVSIPYLVFNEIFQGSLPEEYDI 71 Query: 380 EPLIYQILKQHKGPLLKFAL 439 EP+IYQIL HKGP++KF L Sbjct: 72 EPIIYQILLLHKGPIIKFIL 91 >ref|XP_016501805.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Nicotiana tabacum] Length = 421 Score = 93.2 bits (230), Expect = 2e-19 Identities = 42/83 (50%), Positives = 60/83 (72%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RS+ D I+NLP N++D ILGCLPL+D V+TSILS++WRYKW + ++ F + F F Sbjct: 6 RSDVDTISNLPCNVVDEILGCLPLKDAVKTSILSKDWRYKWVTRQELDFGYNFFGSFAHD 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L +KGP+LKF L Sbjct: 66 QEAKTIIYQVLLIYKGPILKFKL 88 >ref|XP_016501803.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Nicotiana tabacum] ref|XP_016501804.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Nicotiana tabacum] Length = 422 Score = 93.2 bits (230), Expect = 2e-19 Identities = 42/83 (50%), Positives = 60/83 (72%) Frame = +2 Query: 191 RSESDFITNLPNNIIDNILGCLPLRDVVRTSILSREWRYKWTSCPDIVFDFWFDQMFLGG 370 RS+ D I+NLP N++D ILGCLPL+D V+TSILS++WRYKW + ++ F + F F Sbjct: 6 RSDVDTISNLPCNVVDEILGCLPLKDAVKTSILSKDWRYKWVTRQELDFGYNFFGSFAHD 65 Query: 371 HKLEPLIYQILKQHKGPLLKFAL 439 + + +IYQ+L +KGP+LKF L Sbjct: 66 QEAKTIIYQVLLIYKGPILKFKL 88