BLASTX nr result
ID: Rehmannia30_contig00024670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00024670 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023876019.1| 26S proteasome regulatory subunit 10B homolo... 89 1e-19 gb|ACF87085.1| unknown [Zea mays] >gi|238012976|gb|ACR37523.1| u... 86 9e-19 gb|OAY67939.1| 26S protease regulatory subunit S10B [Ananas como... 89 1e-18 gb|AFK35582.1| unknown [Medicago truncatula] 86 3e-18 ref|XP_021603096.1| 26S proteasome regulatory subunit S10B homol... 87 4e-18 ref|XP_017611577.1| PREDICTED: 26S protease regulatory subunit S... 91 7e-18 gb|PIM98897.1| 26S proteasome regulatory complex, ATPase RPT4 [H... 91 7e-18 ref|XP_011092817.1| 26S protease regulatory subunit S10B homolog... 91 7e-18 ref|XP_011088447.1| 26S protease regulatory subunit S10B homolog... 91 7e-18 ref|XP_016435086.1| PREDICTED: 26S protease regulatory subunit 1... 89 9e-18 gb|AFK34932.1| unknown [Lotus japonicus] 86 1e-17 gb|OAY21341.1| hypothetical protein MANES_S096100, partial [Mani... 87 1e-17 gb|ACJ83579.1| unknown [Medicago truncatula] 86 1e-17 ref|XP_018843836.1| PREDICTED: 26S protease regulatory subunit S... 88 2e-17 ref|XP_022898643.1| 26S proteasome regulatory subunit S10B homol... 89 2e-17 ref|XP_021636496.1| 26S proteasome regulatory subunit S10B homol... 89 2e-17 gb|PPD86173.1| hypothetical protein GOBAR_DD16891 [Gossypium bar... 89 2e-17 ref|XP_022761945.1| 26S proteasome regulatory subunit S10B homol... 89 3e-17 ref|XP_016693474.1| PREDICTED: 26S protease regulatory subunit S... 89 3e-17 ref|XP_012478106.1| PREDICTED: 26S protease regulatory subunit S... 89 3e-17 >ref|XP_023876019.1| 26S proteasome regulatory subunit 10B homolog A-like [Quercus suber] gb|POE81710.1| 26s protease regulatory subunit 10b like a [Quercus suber] Length = 84 Score = 88.6 bits (218), Expect = 1e-19 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYS DFGKD Sbjct: 41 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSADFGKD 84 >gb|ACF87085.1| unknown [Zea mays] gb|ACR37523.1| unknown [Zea mays] Length = 84 Score = 86.3 bits (212), Expect = 9e-19 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGM+AIRAERDYVIHEDFMKAVRKLN+AKKLESSAHYS DFGKD Sbjct: 41 AGMAAIRAERDYVIHEDFMKAVRKLNDAKKLESSAHYSADFGKD 84 >gb|OAY67939.1| 26S protease regulatory subunit S10B [Ananas comosus] Length = 176 Score = 88.6 bits (218), Expect = 1e-18 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYS DFGKD Sbjct: 133 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSADFGKD 176 >gb|AFK35582.1| unknown [Medicago truncatula] Length = 119 Score = 85.9 bits (211), Expect = 3e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY+ DFGK+ Sbjct: 76 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGKE 119 >ref|XP_021603096.1| 26S proteasome regulatory subunit S10B homolog B-like [Manihot esculenta] Length = 176 Score = 87.4 bits (215), Expect = 4e-18 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY+ DFGKD Sbjct: 133 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGKD 176 >ref|XP_017611577.1| PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Gossypium arboreum] gb|KHG27000.1| 26S protease regulatory subunit S10B B -like protein [Gossypium arboreum] Length = 398 Score = 90.5 bits (223), Expect = 7e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD Sbjct: 355 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 398 >gb|PIM98897.1| 26S proteasome regulatory complex, ATPase RPT4 [Handroanthus impetiginosus] Length = 399 Score = 90.5 bits (223), Expect = 7e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD Sbjct: 356 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 399 >ref|XP_011092817.1| 26S protease regulatory subunit S10B homolog B [Sesamum indicum] Length = 399 Score = 90.5 bits (223), Expect = 7e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD Sbjct: 356 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 399 >ref|XP_011088447.1| 26S protease regulatory subunit S10B homolog B [Sesamum indicum] Length = 400 Score = 90.5 bits (223), Expect = 7e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD Sbjct: 357 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 400 >ref|XP_016435086.1| PREDICTED: 26S protease regulatory subunit 10B homolog A [Nicotiana tabacum] Length = 272 Score = 88.6 bits (218), Expect = 9e-18 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYS DFGKD Sbjct: 229 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSADFGKD 272 >gb|AFK34932.1| unknown [Lotus japonicus] Length = 176 Score = 86.3 bits (212), Expect = 1e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESS+HY+ DFGKD Sbjct: 133 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSSHYNADFGKD 176 >gb|OAY21341.1| hypothetical protein MANES_S096100, partial [Manihot esculenta] Length = 226 Score = 87.4 bits (215), Expect = 1e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY+ DFGKD Sbjct: 183 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGKD 226 >gb|ACJ83579.1| unknown [Medicago truncatula] Length = 176 Score = 85.9 bits (211), Expect = 1e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY+ DFGK+ Sbjct: 133 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGKE 176 >ref|XP_018843836.1| PREDICTED: 26S protease regulatory subunit S10B homolog B [Juglans regia] Length = 272 Score = 87.8 bits (216), Expect = 2e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLES+AHYS+DFGKD Sbjct: 229 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESTAHYSSDFGKD 272 >ref|XP_022898643.1| 26S proteasome regulatory subunit S10B homolog B-like [Olea europaea var. sylvestris] Length = 399 Score = 89.4 bits (220), Expect = 2e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY+TDFGKD Sbjct: 356 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNTDFGKD 399 >ref|XP_021636496.1| 26S proteasome regulatory subunit S10B homolog B-like [Hevea brasiliensis] Length = 399 Score = 89.4 bits (220), Expect = 2e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY+TDFGKD Sbjct: 356 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNTDFGKD 399 >gb|PPD86173.1| hypothetical protein GOBAR_DD16891 [Gossypium barbadense] Length = 395 Score = 89.0 bits (219), Expect = 2e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGK+ Sbjct: 352 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKE 395 >ref|XP_022761945.1| 26S proteasome regulatory subunit S10B homolog B [Durio zibethinus] Length = 398 Score = 89.0 bits (219), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGK+ Sbjct: 355 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKE 398 >ref|XP_016693474.1| PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Gossypium hirsutum] Length = 398 Score = 89.0 bits (219), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGK+ Sbjct: 355 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKE 398 >ref|XP_012478106.1| PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Gossypium raimondii] gb|KJB29607.1| hypothetical protein B456_005G109900 [Gossypium raimondii] Length = 398 Score = 89.0 bits (219), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 582 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKD 451 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGK+ Sbjct: 355 AGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYSTDFGKE 398