BLASTX nr result
ID: Rehmannia30_contig00024105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00024105 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079489.1| zinc finger protein 598 [Sesamum indicum] 65 9e-09 ref|XP_016466472.1| PREDICTED: zinc finger protein 598-like [Nic... 57 7e-06 ref|XP_009591927.1| PREDICTED: zinc finger protein 598 [Nicotian... 57 7e-06 >ref|XP_011079489.1| zinc finger protein 598 [Sesamum indicum] Length = 851 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 596 KGDSSNGPNNPTESLPVRGVWKNGGGHKLLGMNSKGPKN 480 K SS GPNNP+ESLP RGVW+NGGG KL + SKGPKN Sbjct: 813 KESSSVGPNNPSESLPARGVWRNGGGQKLFALTSKGPKN 851 >ref|XP_016466472.1| PREDICTED: zinc finger protein 598-like [Nicotiana tabacum] Length = 922 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 590 DSSNGPNNPTESLPVRGVWKNGGGHKLLGMNSKGPK 483 ++S+ ++P E LPVRGVW+NGGGHKL+ M SKGPK Sbjct: 886 ETSDEQSDPPEGLPVRGVWRNGGGHKLVAMTSKGPK 921 >ref|XP_009591927.1| PREDICTED: zinc finger protein 598 [Nicotiana tomentosiformis] Length = 922 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 590 DSSNGPNNPTESLPVRGVWKNGGGHKLLGMNSKGPK 483 ++S+ ++P E LPVRGVW+NGGGHKL+ M SKGPK Sbjct: 886 ETSDEQSDPPEGLPVRGVWRNGGGHKLVAMTSKGPK 921