BLASTX nr result
ID: Rehmannia30_contig00021654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021654 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842864.1| PREDICTED: probable methyltransferase PMT3 [... 56 3e-06 >ref|XP_012842864.1| PREDICTED: probable methyltransferase PMT3 [Erythranthe guttata] ref|XP_012842865.1| PREDICTED: probable methyltransferase PMT3 [Erythranthe guttata] ref|XP_012842866.1| PREDICTED: probable methyltransferase PMT3 [Erythranthe guttata] gb|EYU32561.1| hypothetical protein MIMGU_mgv1a002975mg [Erythranthe guttata] Length = 620 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -3 Query: 123 MTRGRPDGAQKKRLLTSLCIVAXXXXXXXXXFGSKNTGESA 1 MTRGR DGAQKKRLLTSLCIVA FGSKN+GESA Sbjct: 1 MTRGRADGAQKKRLLTSLCIVAVFLVFLYVYFGSKNSGESA 41