BLASTX nr result
ID: Rehmannia30_contig00021486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021486 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21826.1| hypothetical protein CDL12_05459 [Handroanthus im... 78 1e-13 ref|XP_011097417.1| uncharacterized protein LOC105176347 [Sesamu... 77 4e-13 ref|XP_011098437.1| uncharacterized protein LOC105177105 [Sesamu... 72 2e-11 gb|PIN04916.1| hypothetical protein CDL12_22552 [Handroanthus im... 67 7e-10 ref|XP_012849767.1| PREDICTED: uncharacterized protein LOC105969... 67 1e-09 emb|CDP02081.1| unnamed protein product [Coffea canephora] 63 1e-08 ref|XP_022895116.1| uncharacterized protein LOC111409314 [Olea e... 62 5e-08 ref|XP_022852865.1| uncharacterized protein LOC111374426 [Olea e... 59 8e-07 gb|KCW55982.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus g... 56 5e-06 gb|KCW55979.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus g... 56 6e-06 gb|KCW55980.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus g... 56 6e-06 ref|XP_010029142.1| PREDICTED: uncharacterized protein LOC104419... 56 7e-06 ref|XP_010029141.1| PREDICTED: uncharacterized protein LOC104419... 56 7e-06 ref|XP_009779082.1| PREDICTED: uncharacterized protein LOC104228... 56 7e-06 >gb|PIN21826.1| hypothetical protein CDL12_05459 [Handroanthus impetiginosus] Length = 369 Score = 78.2 bits (191), Expect = 1e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMM 578 MKRRSNS KFHHRWKRKLF +LL A C ATFVLMESQYSRI+M+ Sbjct: 1 MKRRSNSQKFHHRWKRKLFAVLLFAFCLATFVLMESQYSRIEML 44 >ref|XP_011097417.1| uncharacterized protein LOC105176347 [Sesamum indicum] Length = 371 Score = 77.0 bits (188), Expect = 4e-13 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMMT 581 M+RRSNS KFHHRWKRKL LLL CFATFVLMES+YSRIKM++ Sbjct: 1 MRRRSNSHKFHHRWKRKLLAALLLGFCFATFVLMESEYSRIKMLS 45 >ref|XP_011098437.1| uncharacterized protein LOC105177105 [Sesamum indicum] Length = 370 Score = 72.4 bits (176), Expect = 2e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMMT 581 MKR+ NS K+HHRWKRKL +LLL CFATFV+MESQY+ IKM+T Sbjct: 1 MKRKPNSHKYHHRWKRKLLVVLLLVFCFATFVVMESQYNSIKMLT 45 >gb|PIN04916.1| hypothetical protein CDL12_22552 [Handroanthus impetiginosus] Length = 266 Score = 67.0 bits (162), Expect = 7e-10 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMMT 581 M RRS+S KFHHRWKRK +LL+ C ATFVLMESQ SRIKM T Sbjct: 1 MTRRSSSQKFHHRWKRKPLAMLLICFCLATFVLMESQCSRIKMPT 45 >ref|XP_012849767.1| PREDICTED: uncharacterized protein LOC105969540 [Erythranthe guttata] gb|EYU44778.1| hypothetical protein MIMGU_mgv1a008498mg [Erythranthe guttata] Length = 371 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMMT 581 MKRRS+ KFHHRW+RK F LLL C ATF+LME+++SRIK++T Sbjct: 1 MKRRSSLQKFHHRWRRKFFALLLFLFCVATFLLMEAEHSRIKLLT 45 >emb|CDP02081.1| unnamed protein product [Coffea canephora] Length = 252 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +3 Query: 447 MKRRSNSGKF--HHRWKRKLFPLLLLAICFATFVLMESQYSRIKMM 578 MKRRSNS KF HHRWKRKL LLL+ +C T LME+QYSRIK + Sbjct: 1 MKRRSNSQKFPLHHRWKRKLIILLLVGLCLGTVALMETQYSRIKKL 46 >ref|XP_022895116.1| uncharacterized protein LOC111409314 [Olea europaea var. sylvestris] Length = 250 Score = 61.6 bits (148), Expect = 5e-08 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMM 578 MKRRS S KFH RWK KLF ++LL CF T LMES YSRIK++ Sbjct: 1 MKRRSISQKFHQRWKTKLFAVILLVFCFVTLGLMESLYSRIKVL 44 >ref|XP_022852865.1| uncharacterized protein LOC111374426 [Olea europaea var. sylvestris] Length = 368 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMM 578 MKRRS S K H RWK KLF + LL CFAT VLMES Y RIK + Sbjct: 1 MKRRSISQKNHQRWKMKLFAVFLLVFCFATLVLMESLYIRIKFL 44 >gb|KCW55982.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus grandis] Length = 283 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRI 569 MKR+ N K HRWKRKLF +LL +CFA+ +LM +QY+R+ Sbjct: 1 MKRKGNQQKSQHRWKRKLFAAVLLGLCFASLMLMHTQYARV 41 >gb|KCW55979.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus grandis] Length = 313 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRI 569 MKR+ N K HRWKRKLF +LL +CFA+ +LM +QY+R+ Sbjct: 1 MKRKGNQQKSQHRWKRKLFAAVLLGLCFASLMLMHTQYARV 41 >gb|KCW55980.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus grandis] gb|KCW55981.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus grandis] Length = 314 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRI 569 MKR+ N K HRWKRKLF +LL +CFA+ +LM +QY+R+ Sbjct: 1 MKRKGNQQKSQHRWKRKLFAAVLLGLCFASLMLMHTQYARV 41 >ref|XP_010029142.1| PREDICTED: uncharacterized protein LOC104419235 isoform X2 [Eucalyptus grandis] Length = 365 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRI 569 MKR+ N K HRWKRKLF +LL +CFA+ +LM +QY+R+ Sbjct: 1 MKRKGNQQKSQHRWKRKLFAAVLLGLCFASLMLMHTQYARV 41 >ref|XP_010029141.1| PREDICTED: uncharacterized protein LOC104419235 isoform X1 [Eucalyptus grandis] gb|KCW55978.1| hypothetical protein EUGRSUZ_I01758 [Eucalyptus grandis] Length = 366 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRI 569 MKR+ N K HRWKRKLF +LL +CFA+ +LM +QY+R+ Sbjct: 1 MKRKGNQQKSQHRWKRKLFAAVLLGLCFASLMLMHTQYARV 41 >ref|XP_009779082.1| PREDICTED: uncharacterized protein LOC104228335 [Nicotiana sylvestris] ref|XP_016477750.1| PREDICTED: uncharacterized protein LOC107799178 [Nicotiana tabacum] Length = 375 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +3 Query: 447 MKRRSNSGKFHHRWKRKLFPLLLLAICFATFVLMESQYSRIKMM 578 + RRSNS K HRWK K+F ++LL F T V+ME+QYSRI+M+ Sbjct: 5 LMRRSNSQKSQHRWKIKVFVMILLGFFFGTLVIMETQYSRIRML 48