BLASTX nr result
ID: Rehmannia30_contig00021457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021457 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET07432.1| geranylgeranyl pyrophosphate synthase, partial [I... 99 2e-24 gb|PHT71678.1| Heterodimeric geranylgeranyl pyrophosphate syntha... 105 3e-24 ref|XP_016542878.1| PREDICTED: heterodimeric geranylgeranyl pyro... 105 3e-24 gb|PHU06356.1| Heterodimeric geranylgeranyl pyrophosphate syntha... 104 4e-24 ref|NP_001312125.1| heterodimeric geranylgeranyl pyrophosphate s... 103 9e-24 ref|XP_004246572.1| PREDICTED: heterodimeric geranylgeranyl pyro... 103 1e-23 ref|XP_011092951.1| heterodimeric geranylgeranyl pyrophosphate s... 103 1e-23 gb|PHT37849.1| Heterodimeric geranylgeranyl pyrophosphate syntha... 103 1e-23 gb|PIM97890.1| Geranylgeranyl diphosphate synthase [Handroanthus... 100 3e-23 ref|XP_006341179.1| PREDICTED: heterodimeric geranylgeranyl pyro... 102 3e-23 ref|XP_022876147.1| heterodimeric geranylgeranyl pyrophosphate s... 102 3e-23 gb|AST47455.1| geranylgeranyl diphosphate synthase [Camellia sin... 102 3e-23 gb|AIZ00598.1| geranylgeranyl pyrophosphate synthase [Panax noto... 102 4e-23 ref|XP_011046617.1| PREDICTED: heterodimeric geranylgeranyl pyro... 101 6e-23 gb|AMK51093.1| chloroplast geranylgeranyl pyrophosphate synthase... 101 6e-23 ref|XP_019250805.1| PREDICTED: heterodimeric geranylgeranyl pyro... 101 7e-23 ref|XP_011045566.1| PREDICTED: heterodimeric geranylgeranyl pyro... 100 1e-22 ref|XP_018841527.1| PREDICTED: heterodimeric geranylgeranyl pyro... 100 1e-22 ref|NP_001310395.1| heterodimeric geranylgeranyl pyrophosphate s... 100 2e-22 ref|XP_022898674.1| heterodimeric geranylgeranyl pyrophosphate s... 100 3e-22 >gb|AET07432.1| geranylgeranyl pyrophosphate synthase, partial [Ipomoea batatas] Length = 83 Score = 99.0 bits (245), Expect = 2e-24 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHV 255 KKGKSYVSVYGVEKAMEVAE+LR QAKKELD LEKYGDKV+PL+ FVDYA RGF+V Sbjct: 24 KKGKSYVSVYGVEKAMEVAEELRGQAKKELDALEKYGDKVIPLHSFVDYAAYRGFNV 80 >gb|PHT71678.1| Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] Length = 336 Score = 105 bits (261), Expect = 3e-24 Identities = 50/60 (83%), Positives = 53/60 (88%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYVSVYGVEKAMEVAEDLR QAK+ELDG EKYGDKV+PLY FVDYA DRGF + Q Sbjct: 276 KKGKSYVSVYGVEKAMEVAEDLRTQAKRELDGFEKYGDKVMPLYSFVDYAADRGFTIDTQ 335 >ref|XP_016542878.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] ref|XP_016542879.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] ref|XP_016542880.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] ref|XP_016542881.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] ref|XP_016542882.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] Length = 336 Score = 105 bits (261), Expect = 3e-24 Identities = 50/60 (83%), Positives = 53/60 (88%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYVSVYGVEKAMEVAEDLR QAK+ELDG EKYGDKV+PLY FVDYA DRGF + Q Sbjct: 276 KKGKSYVSVYGVEKAMEVAEDLRTQAKRELDGFEKYGDKVMPLYSFVDYAADRGFTIDTQ 335 >gb|PHU06356.1| Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum chinense] Length = 336 Score = 104 bits (260), Expect = 4e-24 Identities = 50/60 (83%), Positives = 53/60 (88%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYVSVYGVEKAMEVAEDLR QAK+ELDG EKYGDKV+PLY FVDYA DRGF + Q Sbjct: 276 KKGKSYVSVYGVEKAMEVAEDLRMQAKRELDGFEKYGDKVMPLYSFVDYAADRGFTIDTQ 335 >ref|NP_001312125.1| heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] ref|XP_009788757.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana sylvestris] ref|XP_009788758.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana sylvestris] ref|XP_009788759.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana sylvestris] ref|XP_016450347.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] ref|XP_016450348.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] gb|AIC77784.1| geranylgeranyl pyrophosphate synthase 5 [Nicotiana tabacum] gb|AIC77785.1| geranylgeranyl pyrophosphate synthase 5 [Nicotiana tabacum] Length = 332 Score = 103 bits (257), Expect = 9e-24 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGF 261 KKGKSYVS+YG+EKAMEVAEDLRAQAK+ELDGL+KYGDKV+PLY FVDYA DRGF Sbjct: 274 KKGKSYVSLYGIEKAMEVAEDLRAQAKRELDGLKKYGDKVIPLYSFVDYAADRGF 328 >ref|XP_004246572.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Solanum lycopersicum] ref|XP_010325942.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Solanum lycopersicum] ref|XP_010325943.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Solanum lycopersicum] Length = 334 Score = 103 bits (257), Expect = 1e-23 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYVSVYG+EKA++VAEDLRAQAK+ELDGLEKYGDKV+PLY F+DYA DRGF + Q Sbjct: 274 KKGKSYVSVYGIEKAVKVAEDLRAQAKRELDGLEKYGDKVMPLYSFLDYAADRGFSIDGQ 333 >ref|XP_011092951.1| heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Sesamum indicum] Length = 332 Score = 103 bits (256), Expect = 1e-23 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGF 261 KKGKSYVSVYGVEKA+EVAEDLR+QAKKELDGLE+YG+KVLPLY FVDYA DRGF Sbjct: 272 KKGKSYVSVYGVEKAIEVAEDLRSQAKKELDGLERYGEKVLPLYSFVDYAADRGF 326 >gb|PHT37849.1| Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum baccatum] Length = 337 Score = 103 bits (256), Expect = 1e-23 Identities = 49/59 (83%), Positives = 52/59 (88%) Frame = -1 Query: 422 KGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KGKSYVSVYGVEKAMEVAEDLR QAK+ELDG EKYGDKV+PLY FVDYA DRGF + Q Sbjct: 278 KGKSYVSVYGVEKAMEVAEDLRTQAKRELDGFEKYGDKVMPLYSFVDYAADRGFTIDTQ 336 >gb|PIM97890.1| Geranylgeranyl diphosphate synthase [Handroanthus impetiginosus] Length = 207 Score = 99.8 bits (247), Expect = 3e-23 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGF 261 KK KSYVSVYGVEKAMEVA++LR+QAKKEL+GLEKYGDKVLPLY F+DYA DRGF Sbjct: 147 KKSKSYVSVYGVEKAMEVADELRSQAKKELEGLEKYGDKVLPLYSFLDYAADRGF 201 >ref|XP_006341179.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum tuberosum] ref|XP_006341180.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum tuberosum] ref|XP_006341181.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum tuberosum] Length = 334 Score = 102 bits (254), Expect = 3e-23 Identities = 47/60 (78%), Positives = 55/60 (91%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYVSVYG+EKA++VAEDL AQAK+ELDGLEKYGDKV+PLY F+DYA DRGF + +Q Sbjct: 274 KKGKSYVSVYGIEKAVKVAEDLGAQAKRELDGLEKYGDKVMPLYSFLDYAADRGFSIDDQ 333 >ref|XP_022876147.1| heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Olea europaea var. sylvestris] Length = 340 Score = 102 bits (254), Expect = 3e-23 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 422 KGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 K KSYV+ YGV+KAMEVAEDLRAQAKKELDGLE+YG+KV+PLY FVDYA DRGF VG+Q Sbjct: 280 KSKSYVAAYGVDKAMEVAEDLRAQAKKELDGLEEYGEKVVPLYSFVDYAADRGFSVGDQ 338 >gb|AST47455.1| geranylgeranyl diphosphate synthase [Camellia sinensis] Length = 340 Score = 102 bits (254), Expect = 3e-23 Identities = 48/60 (80%), Positives = 54/60 (90%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYV VYGVEKAMEVA +LRA+AK+ELDG EKYG+KV+PLY FVDYA DRGF VG+Q Sbjct: 280 KKGKSYVGVYGVEKAMEVAAELRAKAKRELDGFEKYGEKVVPLYSFVDYAADRGFSVGDQ 339 >gb|AIZ00598.1| geranylgeranyl pyrophosphate synthase [Panax notoginseng] Length = 343 Score = 102 bits (253), Expect = 4e-23 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 422 KGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KGKSYVSVYGVEKAMEVAEDLR +AK+ELD +KYG++VLPLY FVDYAVDRGF VG+Q Sbjct: 284 KGKSYVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGERVLPLYSFVDYAVDRGFSVGDQ 342 >ref|XP_011046617.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Populus euphratica] Length = 347 Score = 101 bits (252), Expect = 6e-23 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGE 249 KKGKSYV+VYGVEKA EVAE+LRA+AKKELDG EKYGD V+PLY FVDYA DRGF +GE Sbjct: 287 KKGKSYVAVYGVEKAAEVAEELRAKAKKELDGFEKYGDSVVPLYSFVDYAADRGFSLGE 345 >gb|AMK51093.1| chloroplast geranylgeranyl pyrophosphate synthase 1 [Rehmannia glutinosa] Length = 328 Score = 101 bits (251), Expect = 6e-23 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGF 261 KKGKSYVS+YGV+KAMEVAEDLR+QAKKELD LEKYG+KVLPLY FVDYA DRGF Sbjct: 268 KKGKSYVSLYGVDKAMEVAEDLRSQAKKELDALEKYGEKVLPLYSFVDYAADRGF 322 >ref|XP_019250805.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] ref|XP_019250806.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] ref|XP_019250807.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] ref|XP_019250808.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] gb|OIT01464.1| heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Nicotiana attenuata] Length = 332 Score = 101 bits (251), Expect = 7e-23 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGF 261 KKGKSYVS+YG+EKA +VAEDLRAQAK+ELDGLEKYGDKV+PLY FVDYA DRGF Sbjct: 274 KKGKSYVSLYGIEKAKKVAEDLRAQAKRELDGLEKYGDKVIPLYSFVDYAADRGF 328 >ref|XP_011045566.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Populus euphratica] Length = 345 Score = 100 bits (250), Expect = 1e-22 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGE 249 KKGKSYV+ YGVEKA+EVAE+LRA+AKKELDG EKYGD VLPLY FVDYA DRGF GE Sbjct: 285 KKGKSYVAFYGVEKAIEVAEELRAKAKKELDGFEKYGDSVLPLYSFVDYAADRGFSFGE 343 >ref|XP_018841527.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Juglans regia] Length = 332 Score = 100 bits (249), Expect = 1e-22 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGE 249 KKGKSYV +YGVEKAMEVAE+LR +AKKELDG EKYG+ V+PLY FVDYA+DRGF VG+ Sbjct: 272 KKGKSYVGLYGVEKAMEVAEELRTKAKKELDGFEKYGESVVPLYSFVDYAIDRGFSVGD 330 >ref|NP_001310395.1| heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum pennellii] ref|XP_015087865.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum pennellii] ref|XP_015087867.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum pennellii] gb|ADZ24721.1| geranylgeranyl pyrophosphate synthase 4 [Solanum pennellii] Length = 334 Score = 100 bits (248), Expect = 2e-22 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = -1 Query: 425 KKGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KKGKSYVSVYG+EKA++VAEDLRAQAK+EL GLEKYGDKV+PLY F+DYA DRGF + Q Sbjct: 274 KKGKSYVSVYGIEKAVKVAEDLRAQAKRELVGLEKYGDKVMPLYSFLDYAADRGFSIDGQ 333 >ref|XP_022898674.1| heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Olea europaea var. sylvestris] Length = 341 Score = 99.8 bits (247), Expect = 3e-22 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = -1 Query: 422 KGKSYVSVYGVEKAMEVAEDLRAQAKKELDGLEKYGDKVLPLYHFVDYAVDRGFHVGEQ 246 KGKSYV+ YGVEKAMEV EDLRAQAKKELDGLEKYG+ V+PLY FVDYA DRGF V Q Sbjct: 281 KGKSYVAAYGVEKAMEVGEDLRAQAKKELDGLEKYGELVVPLYSFVDYAADRGFSVDNQ 339