BLASTX nr result
ID: Rehmannia30_contig00020283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00020283 (1122 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02730.1| unnamed protein product [Coffea canephora] 62 6e-08 ref|XP_019246426.1| PREDICTED: uncharacterized protein LOC109226... 61 6e-07 >emb|CDP02730.1| unnamed protein product [Coffea canephora] Length = 166 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 992 VRSLLISRLKCGNSEASFMSEQAILYLGSIGLLGEYCPTSRKK 1120 + +LLIS+ + S+ SFMSE+A+ YLGSIGLLGEYCPTSRKK Sbjct: 68 IYALLISKFEVCQSKISFMSEEAVYYLGSIGLLGEYCPTSRKK 110 >ref|XP_019246426.1| PREDICTED: uncharacterized protein LOC109226077 [Nicotiana attenuata] Length = 236 Score = 60.8 bits (146), Expect = 6e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +2 Query: 1025 GNSEASFMSEQAILYLGSIGLLGEYCPTSRKK 1120 G SE SFMSEQAI YLGSIGLLGEYCPTSRKK Sbjct: 157 GLSETSFMSEQAIFYLGSIGLLGEYCPTSRKK 188