BLASTX nr result
ID: Rehmannia30_contig00020160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00020160 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08792.1| hypothetical protein CDL12_18629 [Handroanthus im... 71 2e-11 ref|XP_011097526.1| E3 ubiquitin-protein ligase RING1-like isofo... 57 1e-06 ref|XP_020554349.1| E3 ubiquitin-protein ligase RING1-like isofo... 57 1e-06 gb|EYU34575.1| hypothetical protein MIMGU_mgv1a019765mg [Erythra... 55 5e-06 ref|XP_012840819.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 55 5e-06 >gb|PIN08792.1| hypothetical protein CDL12_18629 [Handroanthus impetiginosus] Length = 377 Score = 70.9 bits (172), Expect = 2e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 455 GRSLEKGPVSMKRSFSFSGKRSLRKNSRSLESISIPEL 342 GR ++KGPVSMKRSFSFSGKRSLRKNSRSLESISIPEL Sbjct: 337 GRFIQKGPVSMKRSFSFSGKRSLRKNSRSLESISIPEL 374 >ref|XP_011097526.1| E3 ubiquitin-protein ligase RING1-like isoform X2 [Sesamum indicum] Length = 373 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/39 (76%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 455 GRSLEKGPVSMKRSFSFSGKRSLRKN-SRSLESISIPEL 342 GRSL KGPVSMKRSFSFSGKR LRKN SR+ +S+ IPE+ Sbjct: 329 GRSLAKGPVSMKRSFSFSGKRWLRKNGSRTEDSVPIPEI 367 >ref|XP_020554349.1| E3 ubiquitin-protein ligase RING1-like isoform X1 [Sesamum indicum] Length = 378 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/39 (76%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 455 GRSLEKGPVSMKRSFSFSGKRSLRKN-SRSLESISIPEL 342 GRSL KGPVSMKRSFSFSGKR LRKN SR+ +S+ IPE+ Sbjct: 334 GRSLAKGPVSMKRSFSFSGKRWLRKNGSRTEDSVPIPEI 372 >gb|EYU34575.1| hypothetical protein MIMGU_mgv1a019765mg [Erythranthe guttata] Length = 366 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 449 SLEKGPVSMKRSFSFSGKRSLRKNSRSLESISIPEL-*YTKPKPV 318 S++KG VSMKRSFSFSGKRS KNSRS ESI+I EL YTK + + Sbjct: 320 SIQKGSVSMKRSFSFSGKRSSSKNSRSQESITIRELAMYTKSQSI 364 >ref|XP_012840819.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Erythranthe guttata] Length = 393 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 449 SLEKGPVSMKRSFSFSGKRSLRKNSRSLESISIPEL-*YTKPKPV 318 S++KG VSMKRSFSFSGKRS KNSRS ESI+I EL YTK + + Sbjct: 347 SIQKGSVSMKRSFSFSGKRSSSKNSRSQESITIRELAMYTKSQSI 391