BLASTX nr result
ID: Rehmannia30_contig00020022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00020022 (702 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077048.1| calcium-binding mitochondrial carrier protei... 63 1e-07 ref|XP_011102230.1| mitochondrial substrate carrier family prote... 60 9e-07 ref|XP_011102130.1| mitochondrial substrate carrier family prote... 60 9e-07 gb|PIN04548.1| Calmodulin and related proteins (EF-Hand superfam... 57 6e-06 gb|PIN16741.1| Mitochondrial carrier protein PET8 [Handroanthus ... 57 7e-06 ref|XP_022870114.1| uncharacterized protein LOC111389423 [Olea e... 57 8e-06 >ref|XP_011077048.1| calcium-binding mitochondrial carrier protein SCaMC-1 [Sesamum indicum] Length = 827 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 101 MVVSGNDPLESFLNSIQVFKNAFTPLESNFQKV 3 MVVSGNDPLESFLNSIQV KNAF+PLESNF+KV Sbjct: 1 MVVSGNDPLESFLNSIQVVKNAFSPLESNFRKV 33 >ref|XP_011102230.1| mitochondrial substrate carrier family protein C [Sesamum indicum] Length = 797 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 MVVSGNDPLESFLNSIQVFKNAFTPLESNFQKV 3 MVVSGNDPLESFLNS+QV K AF+PLESNF+KV Sbjct: 1 MVVSGNDPLESFLNSVQVVKTAFSPLESNFRKV 33 >ref|XP_011102130.1| mitochondrial substrate carrier family protein C-like [Sesamum indicum] ref|XP_020547252.1| mitochondrial substrate carrier family protein C-like [Sesamum indicum] Length = 797 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 MVVSGNDPLESFLNSIQVFKNAFTPLESNFQKV 3 MVVSGNDPLESFLNS+QV K AF+PLESNF+KV Sbjct: 1 MVVSGNDPLESFLNSVQVVKTAFSPLESNFRKV 33 >gb|PIN04548.1| Calmodulin and related proteins (EF-Hand superfamily) [Handroanthus impetiginosus] Length = 494 Score = 57.4 bits (137), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 101 MVVSGNDPLESFLNSIQVFKNAFTPLESNFQKV 3 MVV GNDPLESF NSIQV KN F+PLESNF+K+ Sbjct: 1 MVVPGNDPLESFFNSIQVVKNVFSPLESNFRKI 33 >gb|PIN16741.1| Mitochondrial carrier protein PET8 [Handroanthus impetiginosus] Length = 809 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 101 MVVSGNDPLESFLNSIQVFKNAFTPLESNFQKV 3 MVV GNDPLESF NSIQV KN F+PLESNF+K+ Sbjct: 1 MVVPGNDPLESFFNSIQVVKNVFSPLESNFRKI 33 >ref|XP_022870114.1| uncharacterized protein LOC111389423 [Olea europaea var. sylvestris] Length = 401 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 101 MVVSGNDPLESFLNSIQVFKNAFTPLESNFQK 6 MVVSGNDP+ESFLNS+QV KN F+P+ESNF+K Sbjct: 1 MVVSGNDPVESFLNSLQVVKNVFSPIESNFRK 32