BLASTX nr result
ID: Rehmannia30_contig00018184
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00018184 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077542.1| uncharacterized protein LOC105161520 isoform... 79 2e-14 ref|XP_011077534.1| uncharacterized protein LOC105161520 isoform... 79 3e-14 gb|PIN25921.1| hypothetical protein CDL12_01335 [Handroanthus im... 75 8e-13 gb|PIM98577.1| hypothetical protein CDL12_28939 [Handroanthus im... 75 8e-13 ref|XP_012847521.1| PREDICTED: uncharacterized protein LOC105967... 75 8e-13 gb|PIN25933.1| hypothetical protein CDL12_01347 [Handroanthus im... 69 1e-11 ref|XP_022878383.1| uncharacterized protein LOC111396246 isoform... 71 2e-11 gb|KZV57928.1| hypothetical protein F511_12534 [Dorcoceras hygro... 71 2e-11 ref|XP_022878382.1| uncharacterized protein LOC111396246 isoform... 71 2e-11 gb|KDO70165.1| hypothetical protein CISIN_1g031495mg [Citrus sin... 68 3e-11 ref|XP_022011613.1| uncharacterized protein LOC110911316 isoform... 70 4e-11 gb|KDO70164.1| hypothetical protein CISIN_1g031495mg [Citrus sin... 68 4e-11 gb|PLY86035.1| hypothetical protein LSAT_3X61200 [Lactuca sativa] 69 5e-11 ref|XP_022011612.1| uncharacterized protein LOC110911316 isoform... 70 5e-11 gb|KZM86587.1| hypothetical protein DCAR_023721 [Daucus carota s... 69 6e-11 ref|XP_020102294.1| uncharacterized protein LOC109719876 [Ananas... 66 6e-11 ref|XP_017216514.1| PREDICTED: uncharacterized protein LOC108194... 69 7e-11 ref|XP_010257822.1| PREDICTED: uncharacterized protein LOC104597... 69 7e-11 gb|KVH96318.1| hypothetical protein Ccrd_001595 [Cynara carduncu... 69 9e-11 gb|OAY64156.1| hypothetical protein ACMD2_13507 [Ananas comosus] 66 9e-11 >ref|XP_011077542.1| uncharacterized protein LOC105161520 isoform X2 [Sesamum indicum] Length = 273 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLHLLYA+FFTRLGMKASLRLPKWLEAAI Sbjct: 236 LLNCGFFVFLLHLLYAIFFTRLGMKASLRLPKWLEAAI 273 >ref|XP_011077534.1| uncharacterized protein LOC105161520 isoform X1 [Sesamum indicum] Length = 300 Score = 78.6 bits (192), Expect = 3e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLHLLYA+FFTRLGMKASLRLPKWLEAAI Sbjct: 263 LLNCGFFVFLLHLLYAIFFTRLGMKASLRLPKWLEAAI 300 >gb|PIN25921.1| hypothetical protein CDL12_01335 [Handroanthus impetiginosus] Length = 293 Score = 74.7 bits (182), Expect = 8e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLHLLYA+FFTRLGMK+ LRLPKWL+AAI Sbjct: 256 LLNCGFFVFLLHLLYAIFFTRLGMKSELRLPKWLQAAI 293 >gb|PIM98577.1| hypothetical protein CDL12_28939 [Handroanthus impetiginosus] Length = 293 Score = 74.7 bits (182), Expect = 8e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLHLLYA+FFTRLGMK+ LRLPKWL+AAI Sbjct: 256 LLNCGFFVFLLHLLYAIFFTRLGMKSELRLPKWLQAAI 293 >ref|XP_012847521.1| PREDICTED: uncharacterized protein LOC105967469 [Erythranthe guttata] gb|EYU28928.1| hypothetical protein MIMGU_mgv1a010894mg [Erythranthe guttata] Length = 298 Score = 74.7 bits (182), Expect = 8e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCG F FLLHLLYAVFFTRLGMK+SLRLPKWLEAAI Sbjct: 261 LLNCGCFVFLLHLLYAVFFTRLGMKSSLRLPKWLEAAI 298 >gb|PIN25933.1| hypothetical protein CDL12_01347 [Handroanthus impetiginosus] Length = 152 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLN GFF FLLHLLYA+FFT LGMK+ LRLPKWLEAAI Sbjct: 115 LLNFGFFVFLLHLLYAIFFTGLGMKSELRLPKWLEAAI 152 >ref|XP_022878383.1| uncharacterized protein LOC111396246 isoform X2 [Olea europaea var. sylvestris] Length = 272 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC FF FLLHLLYAVFFTRLGMK SL+LPKWL AAI Sbjct: 235 LLNCAFFVFLLHLLYAVFFTRLGMKDSLKLPKWLAAAI 272 >gb|KZV57928.1| hypothetical protein F511_12534 [Dorcoceras hygrometricum] Length = 297 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC F FLLHLLYAVFFTRLGMK SLRLPKWLEA+I Sbjct: 260 LLNCASFVFLLHLLYAVFFTRLGMKTSLRLPKWLEASI 297 >ref|XP_022878382.1| uncharacterized protein LOC111396246 isoform X1 [Olea europaea var. sylvestris] Length = 299 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC FF FLLHLLYAVFFTRLGMK SL+LPKWL AAI Sbjct: 262 LLNCAFFVFLLHLLYAVFFTRLGMKDSLKLPKWLAAAI 299 >gb|KDO70165.1| hypothetical protein CISIN_1g031495mg [Citrus sinensis] Length = 147 Score = 67.8 bits (164), Expect = 3e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLN GFF FLLHLLY+VF TRLGMKASLRLP+WLE A+ Sbjct: 110 LLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 147 >ref|XP_022011613.1| uncharacterized protein LOC110911316 isoform X2 [Helianthus annuus] Length = 258 Score = 69.7 bits (169), Expect = 4e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC FF FLLHLLYA+FFTRLGMKASLRLPKW AI Sbjct: 221 LLNCSFFVFLLHLLYALFFTRLGMKASLRLPKWFAKAI 258 >gb|KDO70164.1| hypothetical protein CISIN_1g031495mg [Citrus sinensis] Length = 158 Score = 67.8 bits (164), Expect = 4e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLN GFF FLLHLLY+VF TRLGMKASLRLP+WLE A+ Sbjct: 121 LLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 158 >gb|PLY86035.1| hypothetical protein LSAT_3X61200 [Lactuca sativa] Length = 208 Score = 68.6 bits (166), Expect = 5e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC FF FLLHLLYA+FFTRLGMKASLRLPKW AI Sbjct: 171 LLNCCFFVFLLHLLYALFFTRLGMKASLRLPKWFAKAI 208 >ref|XP_022011612.1| uncharacterized protein LOC110911316 isoform X1 [Helianthus annuus] gb|OTF94781.1| hypothetical protein HannXRQ_Chr15g0475871 [Helianthus annuus] Length = 292 Score = 69.7 bits (169), Expect = 5e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC FF FLLHLLYA+FFTRLGMKASLRLPKW AI Sbjct: 255 LLNCSFFVFLLHLLYALFFTRLGMKASLRLPKWFAKAI 292 >gb|KZM86587.1| hypothetical protein DCAR_023721 [Daucus carota subsp. sativus] Length = 269 Score = 69.3 bits (168), Expect = 6e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 L+NCGFF FLLHLLY+VFFTRLGMK SLRLP WL+ AI Sbjct: 232 LMNCGFFVFLLHLLYSVFFTRLGMKESLRLPGWLDKAI 269 >ref|XP_020102294.1| uncharacterized protein LOC109719876 [Ananas comosus] Length = 102 Score = 65.9 bits (159), Expect = 6e-11 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLH+LYAV T+LG++ASL+LPKWL+ AI Sbjct: 65 LLNCGFFVFLLHILYAVILTKLGLRASLKLPKWLDKAI 102 >ref|XP_017216514.1| PREDICTED: uncharacterized protein LOC108194126 [Daucus carota subsp. sativus] Length = 290 Score = 69.3 bits (168), Expect = 7e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 L+NCGFF FLLHLLY+VFFTRLGMK SLRLP WL+ AI Sbjct: 253 LMNCGFFVFLLHLLYSVFFTRLGMKESLRLPGWLDKAI 290 >ref|XP_010257822.1| PREDICTED: uncharacterized protein LOC104597801 isoform X1 [Nelumbo nucifera] Length = 293 Score = 69.3 bits (168), Expect = 7e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLH+LYAVF TRLGMK SL+LP+WLE A+ Sbjct: 256 LLNCGFFIFLLHILYAVFLTRLGMKTSLKLPRWLEKAV 293 >gb|KVH96318.1| hypothetical protein Ccrd_001595 [Cynara cardunculus var. scolymus] Length = 250 Score = 68.6 bits (166), Expect = 9e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNC FF FLLHLLYA+FFTRLGMKASLRLPKW AI Sbjct: 213 LLNCCFFVFLLHLLYALFFTRLGMKASLRLPKWFAKAI 250 >gb|OAY64156.1| hypothetical protein ACMD2_13507 [Ananas comosus] Length = 119 Score = 65.9 bits (159), Expect = 9e-11 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFAFLLHLLYAVFFTRLGMKASLRLPKWLEAAI 114 LLNCGFF FLLH+LYAV T+LG++ASL+LPKWL+ AI Sbjct: 82 LLNCGFFVFLLHILYAVILTKLGLRASLKLPKWLDKAI 119