BLASTX nr result
ID: Rehmannia30_contig00016449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00016449 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI69717.1| hypothetical protein CRG98_009873 [Punica granatum] 107 2e-27 gb|PKI48035.1| hypothetical protein CRG98_031552 [Punica granatum] 107 4e-27 gb|OIS97047.1| putative e3 ubiquitin-protein ligase rhg1a [Nicot... 105 3e-26 gb|EYU36346.1| hypothetical protein MIMGU_mgv1a005432mg [Erythra... 112 4e-26 gb|EYU36345.1| hypothetical protein MIMGU_mgv1a005432mg [Erythra... 112 5e-26 ref|XP_014625385.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-... 104 5e-26 ref|XP_012838759.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-... 112 6e-26 ref|XP_020548247.1| probable E3 ubiquitin-protein ligase RHG1A [... 111 1e-25 ref|XP_011038595.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-... 103 1e-25 gb|PIN17932.1| Anaphase-promoting complex (APC), subunit 11 [Han... 108 1e-24 ref|XP_011069666.1| probable E3 ubiquitin-protein ligase RHG1A i... 108 1e-24 ref|XP_011069665.1| probable E3 ubiquitin-protein ligase RHG1A i... 108 1e-24 gb|OWM70862.1| hypothetical protein CDL15_Pgr014535 [Punica gran... 107 3e-24 gb|AHW48349.1| C3HC4-type RING finger protein [Nicotiana bentham... 102 3e-24 gb|OWM80709.1| hypothetical protein CDL15_Pgr006739 [Punica gran... 107 3e-24 ref|XP_012851729.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-... 106 6e-24 ref|XP_012851728.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-... 106 6e-24 gb|EYU25442.1| hypothetical protein MIMGU_mgv11b002235mg [Erythr... 106 7e-24 ref|XP_016475330.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-... 106 7e-24 ref|XP_009619261.1| PREDICTED: probable E3 ubiquitin-protein lig... 106 7e-24 >gb|PKI69717.1| hypothetical protein CRG98_009873 [Punica granatum] Length = 121 Score = 107 bits (268), Expect = 2e-27 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC +C+EEYNDGED+GTLECGHDFHRDCIKQWLM KNLCPICKT GL+T Sbjct: 72 EPCCVCQEEYNDGEDIGTLECGHDFHRDCIKQWLMHKNLCPICKTAGLST 121 >gb|PKI48035.1| hypothetical protein CRG98_031552 [Punica granatum] Length = 132 Score = 107 bits (267), Expect = 4e-27 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC IC+EEYNDGEDLGTLECGHDFH+DCIKQWLM KNLCPICKT GL+T Sbjct: 83 EPCCICQEEYNDGEDLGTLECGHDFHKDCIKQWLMHKNLCPICKTMGLST 132 >gb|OIS97047.1| putative e3 ubiquitin-protein ligase rhg1a [Nicotiana attenuata] Length = 133 Score = 105 bits (262), Expect = 3e-26 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGL 302 EPC IC+EEYNDGEDLGTLECGHDFHRDCIKQWL KN+CPICKTTGL Sbjct: 84 EPCCICQEEYNDGEDLGTLECGHDFHRDCIKQWLKHKNICPICKTTGL 131 >gb|EYU36346.1| hypothetical protein MIMGU_mgv1a005432mg [Erythranthe guttata] Length = 483 Score = 112 bits (279), Expect = 4e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEYNDGEDLGTLEC HDFH+DCIKQWLMQKNLCPICKTTGL+T Sbjct: 434 EPCSICREEYNDGEDLGTLECEHDFHKDCIKQWLMQKNLCPICKTTGLST 483 >gb|EYU36345.1| hypothetical protein MIMGU_mgv1a005432mg [Erythranthe guttata] Length = 484 Score = 112 bits (279), Expect = 5e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEYNDGEDLGTLEC HDFH+DCIKQWLMQKNLCPICKTTGL+T Sbjct: 435 EPCSICREEYNDGEDLGTLECEHDFHKDCIKQWLMQKNLCPICKTTGLST 484 >ref|XP_014625385.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Glycine max] gb|KRH05664.1| hypothetical protein GLYMA_17G240900 [Glycine max] Length = 121 Score = 104 bits (259), Expect = 5e-26 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC +C+EEY DG+DLG+L+CGHD+HRDCIKQWLM KNLCPICKTTGLAT Sbjct: 72 EPCCVCQEEYKDGDDLGSLDCGHDYHRDCIKQWLMHKNLCPICKTTGLAT 121 >ref|XP_012838759.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-like [Erythranthe guttata] Length = 535 Score = 112 bits (279), Expect = 6e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEYNDGEDLGTLEC HDFH+DCIKQWLMQKNLCPICKTTGL+T Sbjct: 486 EPCSICREEYNDGEDLGTLECEHDFHKDCIKQWLMQKNLCPICKTTGLST 535 >ref|XP_020548247.1| probable E3 ubiquitin-protein ligase RHG1A [Sesamum indicum] Length = 723 Score = 111 bits (278), Expect = 1e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEYN+GED+GTLECGHDFHRDCIKQWLM KNLCPICKTTGL T Sbjct: 674 EPCSICREEYNEGEDIGTLECGHDFHRDCIKQWLMHKNLCPICKTTGLTT 723 >ref|XP_011038595.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Populus euphratica] Length = 133 Score = 103 bits (257), Expect = 1e-25 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC IC+EEYNDGEDLGTL+CGHDFH +C+KQWLM KN CPICKTTGLAT Sbjct: 84 EPCCICQEEYNDGEDLGTLDCGHDFHVECVKQWLMHKNWCPICKTTGLAT 133 >gb|PIN17932.1| Anaphase-promoting complex (APC), subunit 11 [Handroanthus impetiginosus] Length = 713 Score = 108 bits (271), Expect = 1e-24 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGL 302 EPCSICREEYNDGEDLG LECGH+FH+DCIKQWLMQKNLCPICKTTGL Sbjct: 664 EPCSICREEYNDGEDLGILECGHEFHKDCIKQWLMQKNLCPICKTTGL 711 >ref|XP_011069666.1| probable E3 ubiquitin-protein ligase RHG1A isoform X2 [Sesamum indicum] Length = 718 Score = 108 bits (271), Expect = 1e-24 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEYNDGEDLG LECGHDFH DCIKQWL QKNLCPICKTTGL T Sbjct: 669 EPCSICREEYNDGEDLGMLECGHDFHTDCIKQWLTQKNLCPICKTTGLTT 718 >ref|XP_011069665.1| probable E3 ubiquitin-protein ligase RHG1A isoform X1 [Sesamum indicum] ref|XP_020554454.1| probable E3 ubiquitin-protein ligase RHG1A isoform X1 [Sesamum indicum] Length = 719 Score = 108 bits (271), Expect = 1e-24 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEYNDGEDLG LECGHDFH DCIKQWL QKNLCPICKTTGL T Sbjct: 670 EPCSICREEYNDGEDLGMLECGHDFHTDCIKQWLTQKNLCPICKTTGLTT 719 >gb|OWM70862.1| hypothetical protein CDL15_Pgr014535 [Punica granatum] Length = 704 Score = 107 bits (268), Expect = 3e-24 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC +C+EEYNDGED+GTLECGHDFHRDCIKQWLM KNLCPICKT GL+T Sbjct: 655 EPCCVCQEEYNDGEDIGTLECGHDFHRDCIKQWLMHKNLCPICKTAGLST 704 >gb|AHW48349.1| C3HC4-type RING finger protein [Nicotiana benthamiana] Length = 191 Score = 102 bits (253), Expect = 3e-24 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC +C+EEY DGEDLG L+CGHDFH DCIKQW MQKNLCPICKTTGL T Sbjct: 142 EPCCVCQEEYKDGEDLGKLDCGHDFHTDCIKQWFMQKNLCPICKTTGLKT 191 >gb|OWM80709.1| hypothetical protein CDL15_Pgr006739 [Punica granatum] Length = 573 Score = 107 bits (267), Expect = 3e-24 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC IC+EEYNDGEDLGTLECGHDFH+DCIKQWLM KNLCPICKT GL+T Sbjct: 524 EPCCICQEEYNDGEDLGTLECGHDFHKDCIKQWLMHKNLCPICKTMGLST 573 >ref|XP_012851729.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X2 [Erythranthe guttata] Length = 597 Score = 106 bits (265), Expect = 6e-24 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEY D EDLGTLECGHDFH+DCI QWLMQKN+CPICKTTGL T Sbjct: 548 EPCSICREEYKDDEDLGTLECGHDFHKDCISQWLMQKNICPICKTTGLKT 597 >ref|XP_012851728.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X1 [Erythranthe guttata] Length = 598 Score = 106 bits (265), Expect = 6e-24 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEY D EDLGTLECGHDFH+DCI QWLMQKN+CPICKTTGL T Sbjct: 549 EPCSICREEYKDDEDLGTLECGHDFHKDCISQWLMQKNICPICKTTGLKT 598 >gb|EYU25442.1| hypothetical protein MIMGU_mgv11b002235mg [Erythranthe guttata] Length = 639 Score = 106 bits (265), Expect = 7e-24 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPCSICREEY D EDLGTLECGHDFH+DCI QWLMQKN+CPICKTTGL T Sbjct: 590 EPCSICREEYKDDEDLGTLECGHDFHKDCISQWLMQKNICPICKTTGLKT 639 >ref|XP_016475330.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Nicotiana tabacum] Length = 720 Score = 106 bits (265), Expect = 7e-24 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC IC+EEYNDGEDLGTLECGHDFHRDCIKQWL KN+CPICKTTGL T Sbjct: 671 EPCCICQEEYNDGEDLGTLECGHDFHRDCIKQWLKHKNICPICKTTGLNT 720 >ref|XP_009619261.1| PREDICTED: probable E3 ubiquitin-protein ligase RHG1A [Nicotiana tomentosiformis] ref|XP_018631502.1| PREDICTED: probable E3 ubiquitin-protein ligase RHG1A [Nicotiana tomentosiformis] ref|XP_018631503.1| PREDICTED: probable E3 ubiquitin-protein ligase RHG1A [Nicotiana tomentosiformis] Length = 720 Score = 106 bits (265), Expect = 7e-24 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 445 EPCSICREEYNDGEDLGTLECGHDFHRDCIKQWLMQKNLCPICKTTGLAT 296 EPC IC+EEYNDGEDLGTLECGHDFHRDCIKQWL KN+CPICKTTGL T Sbjct: 671 EPCCICQEEYNDGEDLGTLECGHDFHRDCIKQWLKHKNICPICKTTGLNT 720