BLASTX nr result
ID: Rehmannia30_contig00014972
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00014972 (829 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN23651.1| Vesicle coat complex COPII, subunit SEC31 [Handro... 94 6e-18 ref|XP_011088124.1| protein transport protein SEC31 homolog B [S... 93 2e-17 ref|XP_012849694.1| PREDICTED: protein transport protein SEC31 h... 91 1e-16 ref|XP_022876637.1| protein transport protein SEC31 homolog B [O... 87 1e-15 emb|CDP18776.1| unnamed protein product [Coffea canephora] 84 2e-14 gb|EPS70248.1| hypothetical protein M569_04512, partial [Genlise... 82 6e-14 gb|KHN11712.1| Protein transport protein SEC31 [Glycine soja] 81 2e-13 ref|XP_003534381.1| PREDICTED: protein transport protein SEC31 h... 81 2e-13 gb|KRH39898.1| hypothetical protein GLYMA_09G226400 [Glycine max] 81 2e-13 ref|XP_007131398.1| hypothetical protein PHAVU_011G010400g [Phas... 81 2e-13 gb|PIN08433.1| Transcription factor Abd-B, contains HOX domain [... 80 3e-13 gb|KRH23913.1| hypothetical protein GLYMA_12G0103001 [Glycine max] 80 5e-13 gb|KRH23911.1| hypothetical protein GLYMA_12G0103001, partial [G... 80 5e-13 ref|XP_003539884.2| PREDICTED: protein transport protein SEC31 h... 80 5e-13 gb|KHN32395.1| Protein transport protein SEC31 [Glycine soja] 80 5e-13 ref|XP_009602385.1| PREDICTED: protein transport protein SEC31 h... 79 7e-13 ref|XP_016449557.1| PREDICTED: LOW QUALITY PROTEIN: protein tran... 79 7e-13 ref|XP_019450838.1| PREDICTED: protein transport protein SEC31 h... 79 1e-12 ref|XP_019450837.1| PREDICTED: protein transport protein SEC31 h... 79 1e-12 gb|PLY98161.1| hypothetical protein LSAT_1X101701 [Lactuca sativa] 78 2e-12 >gb|PIN23651.1| Vesicle coat complex COPII, subunit SEC31 [Handroanthus impetiginosus] Length = 1133 Score = 94.4 bits (233), Expect = 6e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 688 SVAPLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 +VAPLRAPKWYKRKAGVSFGFGGKLVSFHSAES AGSSEVYVHNLVT Sbjct: 359 AVAPLRAPKWYKRKAGVSFGFGGKLVSFHSAESHAGSSEVYVHNLVT 405 >ref|XP_011088124.1| protein transport protein SEC31 homolog B [Sesamum indicum] Length = 1126 Score = 92.8 bits (229), Expect = 2e-17 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 685 VSVAPLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 V APLRAPKWYKRKAGVSFGFGGKLVSFH+AESP G SEVYVHNLVT Sbjct: 352 VGAAPLRAPKWYKRKAGVSFGFGGKLVSFHAAESPVGPSEVYVHNLVT 399 >ref|XP_012849694.1| PREDICTED: protein transport protein SEC31 homolog B [Erythranthe guttata] gb|EYU27011.1| hypothetical protein MIMGU_mgv1a000475mg [Erythranthe guttata] Length = 1129 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +1 Query: 694 APLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 APLRAPKWYKRKAGVSFGFGGKLVSF++ ESPAGSSEVYVHNLVT Sbjct: 360 APLRAPKWYKRKAGVSFGFGGKLVSFNATESPAGSSEVYVHNLVT 404 >ref|XP_022876637.1| protein transport protein SEC31 homolog B [Olea europaea var. sylvestris] Length = 1133 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +1 Query: 694 APLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 APLRAPKWYKRKAGVSFGFGGKLV+FHSA+S GSSEVYVHNL T Sbjct: 359 APLRAPKWYKRKAGVSFGFGGKLVAFHSADSSTGSSEVYVHNLAT 403 >emb|CDP18776.1| unnamed protein product [Coffea canephora] Length = 1092 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 3/51 (5%) Frame = +1 Query: 685 VSVAPLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSE---VYVHNLVT 828 +S APL+APKWYKRKAGVSFGFGGKLVSF+S E+PAGSSE VYVH+LVT Sbjct: 329 LSTAPLKAPKWYKRKAGVSFGFGGKLVSFNSTEAPAGSSEACSVYVHSLVT 379 >gb|EPS70248.1| hypothetical protein M569_04512, partial [Genlisea aurea] Length = 713 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 688 SVAPLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNL 822 S PLRAPKWYKRK+GVSFGFGGKL+SFHS ESP GSSEV VH+L Sbjct: 358 SAVPLRAPKWYKRKSGVSFGFGGKLISFHSVESPGGSSEVNVHSL 402 >gb|KHN11712.1| Protein transport protein SEC31 [Glycine soja] Length = 1092 Score = 81.3 bits (199), Expect = 2e-13 Identities = 40/48 (83%), Positives = 42/48 (87%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR AGVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 342 PLRAPKWYKRPAGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 389 >ref|XP_003534381.1| PREDICTED: protein transport protein SEC31 homolog B-like [Glycine max] gb|KRH39897.1| hypothetical protein GLYMA_09G226400 [Glycine max] Length = 1118 Score = 81.3 bits (199), Expect = 2e-13 Identities = 40/48 (83%), Positives = 42/48 (87%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR AGVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 353 PLRAPKWYKRPAGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 400 >gb|KRH39898.1| hypothetical protein GLYMA_09G226400 [Glycine max] Length = 1148 Score = 81.3 bits (199), Expect = 2e-13 Identities = 40/48 (83%), Positives = 42/48 (87%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR AGVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 353 PLRAPKWYKRPAGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 400 >ref|XP_007131398.1| hypothetical protein PHAVU_011G010400g [Phaseolus vulgaris] gb|ESW03392.1| hypothetical protein PHAVU_011G010400g [Phaseolus vulgaris] Length = 1117 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR AGVSFGFGGKLVSFH S SPAG+SEVYVHNLVT Sbjct: 353 PLRAPKWYKRPAGVSFGFGGKLVSFHPRASSTGSPAGASEVYVHNLVT 400 >gb|PIN08433.1| Transcription factor Abd-B, contains HOX domain [Handroanthus impetiginosus] Length = 838 Score = 80.5 bits (197), Expect = 3e-13 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 694 APLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 A +APKWY R+AGVSFGFGGKLVSFHS ES AG+SEVYVHNLVT Sbjct: 74 ASFKAPKWYNRRAGVSFGFGGKLVSFHSPESRAGTSEVYVHNLVT 118 >gb|KRH23913.1| hypothetical protein GLYMA_12G0103001 [Glycine max] Length = 865 Score = 79.7 bits (195), Expect = 5e-13 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR GVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 105 PLRAPKWYKRPTGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 152 >gb|KRH23911.1| hypothetical protein GLYMA_12G0103001, partial [Glycine max] gb|KRH23912.1| hypothetical protein GLYMA_12G0103001, partial [Glycine max] Length = 915 Score = 79.7 bits (195), Expect = 5e-13 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR GVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 155 PLRAPKWYKRPTGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 202 >ref|XP_003539884.2| PREDICTED: protein transport protein SEC31 homolog B-like [Glycine max] Length = 1113 Score = 79.7 bits (195), Expect = 5e-13 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR GVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 353 PLRAPKWYKRPTGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 400 >gb|KHN32395.1| Protein transport protein SEC31 [Glycine soja] Length = 1113 Score = 79.7 bits (195), Expect = 5e-13 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +1 Query: 697 PLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 PLRAPKWYKR GVSFGFGGKLVSFH +A SPAG+SEVYVHNLVT Sbjct: 353 PLRAPKWYKRPTGVSFGFGGKLVSFHPRASAAGSPAGASEVYVHNLVT 400 >ref|XP_009602385.1| PREDICTED: protein transport protein SEC31 homolog B [Nicotiana tomentosiformis] Length = 1127 Score = 79.3 bits (194), Expect = 7e-13 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = +1 Query: 682 HVSVAPLRAPKWY-KRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 + APLRAPKW+ K+KAGVSFGFGGKLVSFH+A++P GS+EV+VHN+VT Sbjct: 350 YFGAAPLRAPKWWSKKKAGVSFGFGGKLVSFHAADAPTGSTEVHVHNVVT 399 >ref|XP_016449557.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC31 homolog B-like [Nicotiana tabacum] Length = 1130 Score = 79.3 bits (194), Expect = 7e-13 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = +1 Query: 682 HVSVAPLRAPKWY-KRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 + APLRAPKW+ K+KAGVSFGFGGKLVSFH+A++P GS+EV+VHN+VT Sbjct: 350 YFGAAPLRAPKWWSKKKAGVSFGFGGKLVSFHAADAPTGSTEVHVHNVVT 399 >ref|XP_019450838.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X2 [Lupinus angustifolius] Length = 1113 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 4/51 (7%) Frame = +1 Query: 688 SVAPLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 S LRAPKWYKR AGVSFGFGGKLVSFH +A SPAG+SEVYVHN+VT Sbjct: 350 SAVSLRAPKWYKRPAGVSFGFGGKLVSFHPKPSTAGSPAGASEVYVHNMVT 400 >ref|XP_019450837.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X1 [Lupinus angustifolius] gb|OIW08774.1| hypothetical protein TanjilG_16355 [Lupinus angustifolius] Length = 1116 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 4/51 (7%) Frame = +1 Query: 688 SVAPLRAPKWYKRKAGVSFGFGGKLVSFH----SAESPAGSSEVYVHNLVT 828 S LRAPKWYKR AGVSFGFGGKLVSFH +A SPAG+SEVYVHN+VT Sbjct: 350 SAVSLRAPKWYKRPAGVSFGFGGKLVSFHPKPSTAGSPAGASEVYVHNMVT 400 >gb|PLY98161.1| hypothetical protein LSAT_1X101701 [Lactuca sativa] Length = 1082 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 682 HVSVAPLRAPKWYKRKAGVSFGFGGKLVSFHSAESPAGSSEVYVHNLVT 828 H APL+APKWY+RKAGVSFGFGGKLVSFH+ S +G+SEV VH LVT Sbjct: 352 HYGSAPLKAPKWYQRKAGVSFGFGGKLVSFHTTGSSSGASEVDVHELVT 400