BLASTX nr result
ID: Rehmannia30_contig00014645
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00014645 (701 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN15216.1| hypothetical protein CDL12_12148 [Handroanthus im... 63 4e-08 >gb|PIN15216.1| hypothetical protein CDL12_12148 [Handroanthus impetiginosus] Length = 236 Score = 62.8 bits (151), Expect = 4e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 701 DQTAPRMVSLGNKFDEKNATSRVYCGSGFSFVLRTYDVGSEKR 573 DQT P+ + LG+K D+K AT R+YCGSGFSFV+RT+DV SE + Sbjct: 194 DQTVPQALRLGHKLDQKRATLRIYCGSGFSFVVRTHDVDSETK 236