BLASTX nr result
ID: Rehmannia30_contig00014392
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00014392 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN25834.1| hypothetical protein CDL12_01415 [Handroanthus im... 58 1e-07 gb|PIN01882.1| hypothetical protein CDL12_25607 [Handroanthus im... 58 3e-07 >gb|PIN25834.1| hypothetical protein CDL12_01415 [Handroanthus impetiginosus] Length = 195 Score = 58.2 bits (139), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 305 RLNTFQGFVDLRGVSQHSLRIEAPKHHKQYHFP 403 RLN +QGF+DLRGVSQHSL IEAPKH KQY P Sbjct: 115 RLNAYQGFMDLRGVSQHSLMIEAPKHQKQYIIP 147 >gb|PIN01882.1| hypothetical protein CDL12_25607 [Handroanthus impetiginosus] Length = 312 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 305 RLNTFQGFVDLRGVSQHSLRIEAPKHHKQYHFP 403 RLN +QGF+DLRGVSQHSL IEAPKH KQY P Sbjct: 115 RLNAYQGFMDLRGVSQHSLMIEAPKHQKQYIIP 147