BLASTX nr result
ID: Rehmannia30_contig00012685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00012685 (2351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF25884.1| Os09g0568400, partial [Oryza sativa Japonica Gro... 72 3e-12 dbj|BAS83136.1| Os03g0234200, partial [Oryza sativa Japonica Group] 71 9e-12 pdb|3J61|MM Chain m, Localization Of The Large Subunit Ribosomal... 71 9e-12 gb|KCW48293.1| hypothetical protein EUGRSUZ_K020231, partial [Eu... 70 1e-11 dbj|BAT09489.1| Os09g0568400, partial [Oryza sativa Japonica Group] 70 1e-11 gb|KCW48950.1| hypothetical protein EUGRSUZ_K02560 [Eucalyptus g... 71 2e-11 ref|XP_023881592.1| ubiquitin-60S ribosomal protein L40-2-like, ... 71 2e-11 gb|OVA14764.1| Ubiquitin domain [Macleaya cordata] 71 3e-11 gb|PNS98441.1| hypothetical protein POPTR_016G077200v3 [Populus ... 71 3e-11 gb|ONK57134.1| uncharacterized protein A4U43_C10F16960 [Asparagu... 71 3e-11 gb|KHN02205.1| Ubiquitin-60S ribosomal protein L40 [Glycine soja] 71 3e-11 gb|OAY29871.1| hypothetical protein MANES_15G177700 [Manihot esc... 71 4e-11 gb|OVA10021.1| Ubiquitin domain [Macleaya cordata] 71 4e-11 gb|ABR25730.1| ubiquitin fusion protein, partial [Oryza sativa I... 71 5e-11 gb|PON82875.1| Ubiquitin domain containing protein [Trema orient... 71 5e-11 gb|KGN49832.1| Ubiquitin fusion protein [Cucumis sativus] 71 5e-11 ref|XP_019579078.1| PREDICTED: ubiquitin-60S ribosomal protein L... 71 6e-11 ref|XP_016901146.1| PREDICTED: ubiquitin-60S ribosomal protein L... 71 6e-11 gb|ERN13028.1| hypothetical protein AMTR_s00040p00104050 [Ambore... 71 7e-11 ref|XP_024019683.1| ubiquitin-60S ribosomal protein L40-like [Mo... 71 7e-11 >dbj|BAF25884.1| Os09g0568400, partial [Oryza sativa Japonica Group] dbj|BAT09488.1| Os09g0568400, partial [Oryza sativa Japonica Group] Length = 44 Score = 72.0 bits (175), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 13 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 43 >dbj|BAS83136.1| Os03g0234200, partial [Oryza sativa Japonica Group] Length = 49 Score = 70.9 bits (172), Expect = 9e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 18 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 48 >pdb|3J61|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome Length = 53 Score = 70.9 bits (172), Expect = 9e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 22 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 52 >gb|KCW48293.1| hypothetical protein EUGRSUZ_K020231, partial [Eucalyptus grandis] gb|KDO44260.1| hypothetical protein CISIN_1g0330482mg, partial [Citrus sinensis] Length = 30 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 2248 CYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 1 CYARLHPRAVNCRKKKCGHSNQLRPKKKIK 30 >dbj|BAT09489.1| Os09g0568400, partial [Oryza sativa Japonica Group] Length = 31 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 2248 CYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 1 CYARLHPRAVNCRKKKCGHSNQLRPKKKIK 30 >gb|KCW48950.1| hypothetical protein EUGRSUZ_K02560 [Eucalyptus grandis] Length = 74 Score = 70.9 bits (172), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 44 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 74 >ref|XP_023881592.1| ubiquitin-60S ribosomal protein L40-2-like, partial [Quercus suber] Length = 81 Score = 70.9 bits (172), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 51 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 81 >gb|OVA14764.1| Ubiquitin domain [Macleaya cordata] Length = 98 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 68 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 98 >gb|PNS98441.1| hypothetical protein POPTR_016G077200v3 [Populus trichocarpa] Length = 99 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 69 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 99 >gb|ONK57134.1| uncharacterized protein A4U43_C10F16960 [Asparagus officinalis] gb|ONK71298.1| uncharacterized protein A4U43_C04F7030 [Asparagus officinalis] Length = 99 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 69 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 99 >gb|KHN02205.1| Ubiquitin-60S ribosomal protein L40 [Glycine soja] Length = 99 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 69 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 99 >gb|OAY29871.1| hypothetical protein MANES_15G177700 [Manihot esculenta] Length = 104 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 74 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 104 >gb|OVA10021.1| Ubiquitin domain [Macleaya cordata] Length = 108 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 78 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 108 >gb|ABR25730.1| ubiquitin fusion protein, partial [Oryza sativa Indica Group] Length = 111 Score = 70.9 bits (172), Expect = 5e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 80 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 110 >gb|PON82875.1| Ubiquitin domain containing protein [Trema orientalis] Length = 113 Score = 70.9 bits (172), Expect = 5e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 83 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 113 >gb|KGN49832.1| Ubiquitin fusion protein [Cucumis sativus] Length = 116 Score = 70.9 bits (172), Expect = 5e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 86 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 116 >ref|XP_019579078.1| PREDICTED: ubiquitin-60S ribosomal protein L40, partial [Rhinolophus sinicus] Length = 121 Score = 70.9 bits (172), Expect = 6e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 91 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 121 >ref|XP_016901146.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis melo] Length = 121 Score = 70.9 bits (172), Expect = 6e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 91 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 121 >gb|ERN13028.1| hypothetical protein AMTR_s00040p00104050 [Amborella trichopoda] Length = 127 Score = 70.9 bits (172), Expect = 7e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 97 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 127 >ref|XP_024019683.1| ubiquitin-60S ribosomal protein L40-like [Morus notabilis] Length = 128 Score = 70.9 bits (172), Expect = 7e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 2245 RCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 2337 +CYARLHPRAVNCRKKKCGHSNQLRPKKKIK Sbjct: 98 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 128