BLASTX nr result
ID: Rehmannia30_contig00012379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00012379 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090386.1| zinc finger A20 and AN1 domain-containing st... 87 6e-19 ref|XP_011080262.1| zinc finger A20 and AN1 domain-containing st... 87 7e-19 ref|XP_012829814.1| PREDICTED: zinc finger A20 and AN1 domain-co... 87 9e-19 ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-co... 86 1e-18 gb|PIN18949.1| hypothetical protein CDL12_08352 [Handroanthus im... 86 2e-18 ref|XP_006365818.1| PREDICTED: zinc finger A20 and AN1 domain-co... 86 2e-18 ref|NP_001332859.1| stress-associated protein 10 [Solanum lycope... 86 2e-18 ref|XP_015061916.1| PREDICTED: zinc finger A20 and AN1 domain-co... 86 2e-18 gb|ACM68447.1| stress-associated protein 10 [Solanum lycopersicum] 86 2e-18 dbj|GAU12680.1| hypothetical protein TSUD_121720 [Trifolium subt... 85 3e-18 ref|XP_022005864.1| zinc finger A20 and AN1 domain-containing st... 85 4e-18 gb|ABS72032.1| putative AN1-like zinc finger protein, partial [O... 83 5e-18 ref|XP_022855145.1| zinc finger A20 and AN1 domain-containing st... 85 5e-18 ref|XP_019253711.1| PREDICTED: zinc finger A20 and AN1 domain-co... 86 5e-18 gb|KVI09450.1| Zinc finger, AN1-type [Cynara cardunculus var. sc... 85 5e-18 gb|AMB19672.1| putative A20/AN1-like zinc finger family protein ... 85 5e-18 ref|XP_019237249.1| PREDICTED: zinc finger A20 and AN1 domain-co... 85 6e-18 ref|XP_012828906.1| PREDICTED: zinc finger A20 and AN1 domain-co... 84 7e-18 gb|KZV48851.1| hypothetical protein F511_24710 [Dorcoceras hygro... 84 9e-18 gb|EPS66139.1| hypothetical protein M569_08638, partial [Genlise... 82 9e-18 >ref|XP_011090386.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 143 Score = 87.0 bits (214), Expect = 6e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAKLLKV Sbjct: 103 VFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKLLKV 143 >ref|XP_011080262.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 147 Score = 87.0 bits (214), Expect = 7e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAKLLKV Sbjct: 107 VFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKLLKV 147 >ref|XP_012829814.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU46288.1| hypothetical protein MIMGU_mgv1a015852mg [Erythranthe guttata] Length = 143 Score = 86.7 bits (213), Expect = 9e-19 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGR+AIAKENPV+RAAKLLKV Sbjct: 103 VFCSEHRYSDRHDCSYDYKAAGRDAIAKENPVIRAAKLLKV 143 >ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana sylvestris] Length = 151 Score = 86.3 bits (212), Expect = 1e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAK+LKV Sbjct: 111 VFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 151 >gb|PIN18949.1| hypothetical protein CDL12_08352 [Handroanthus impetiginosus] Length = 142 Score = 85.9 bits (211), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRA+KLLKV Sbjct: 102 VFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRASKLLKV 142 >ref|XP_006365818.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Solanum tuberosum] Length = 159 Score = 86.3 bits (212), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV+AAK+LKV Sbjct: 119 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVKAAKILKV 159 >ref|NP_001332859.1| stress-associated protein 10 [Solanum lycopersicum] Length = 160 Score = 86.3 bits (212), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV+AAK+LKV Sbjct: 120 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVKAAKILKV 160 >ref|XP_015061916.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Solanum pennellii] gb|ACM68460.1| stress-associated protein 10 [Solanum pennellii] Length = 160 Score = 86.3 bits (212), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV+AAK+LKV Sbjct: 120 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVKAAKILKV 160 >gb|ACM68447.1| stress-associated protein 10 [Solanum lycopersicum] Length = 160 Score = 86.3 bits (212), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV+AAK+LKV Sbjct: 120 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVKAAKILKV 160 >dbj|GAU12680.1| hypothetical protein TSUD_121720 [Trifolium subterraneum] Length = 126 Score = 84.7 bits (208), Expect = 3e-18 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 +FCSEHRYSDRHDCSYDYKAAGREAIAKENPV+RAAK++KV Sbjct: 86 LFCSEHRYSDRHDCSYDYKAAGREAIAKENPVIRAAKIVKV 126 >ref|XP_022005864.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Helianthus annuus] gb|OTF99118.1| putative zinc finger, AN1-type [Helianthus annuus] Length = 152 Score = 85.1 bits (209), Expect = 4e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 +FCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAK+LKV Sbjct: 112 MFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 152 >gb|ABS72032.1| putative AN1-like zinc finger protein, partial [Olea europaea] Length = 76 Score = 82.8 bits (203), Expect = 5e-18 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 +FCSEHRYSDRHDC+YDYKAAGREAIA+ENPVV+AAK+LKV Sbjct: 36 MFCSEHRYSDRHDCNYDYKAAGREAIARENPVVKAAKILKV 76 >ref|XP_022855145.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 158 Score = 85.1 bits (209), Expect = 5e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYK+AGREAIA+ENPVVRAAK+LKV Sbjct: 118 VFCSEHRYSDRHDCSYDYKSAGREAIARENPVVRAAKILKV 158 >ref|XP_019253711.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana attenuata] gb|OIS98931.1| zinc finger a20 and an1 domain-containing stress-associated protein 5 [Nicotiana attenuata] Length = 204 Score = 86.3 bits (212), Expect = 5e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV+AAK+LKV Sbjct: 164 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVKAAKILKV 204 >gb|KVI09450.1| Zinc finger, AN1-type [Cynara cardunculus var. scolymus] Length = 159 Score = 85.1 bits (209), Expect = 5e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 +FCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAK+LKV Sbjct: 119 MFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 159 >gb|AMB19672.1| putative A20/AN1-like zinc finger family protein 1 [Taraxacum kok-saghyz] Length = 161 Score = 85.1 bits (209), Expect = 5e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 +FCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAK+LKV Sbjct: 115 MFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 155 >ref|XP_019237249.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana attenuata] gb|OIT22548.1| zinc finger a20 and an1 domain-containing stress-associated protein 5 [Nicotiana attenuata] Length = 151 Score = 84.7 bits (208), Expect = 6e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFCSEHRYSDRHDCSYDYK AGREAIA+ENPVVRAAK+LKV Sbjct: 111 VFCSEHRYSDRHDCSYDYKTAGREAIARENPVVRAAKILKV 151 >ref|XP_012828906.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU18023.1| hypothetical protein MIMGU_mgv1a015860mg [Erythranthe guttata] Length = 143 Score = 84.3 bits (207), Expect = 7e-18 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 6 FCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 FCSEHRYSDRHDCSYDYKAAGREAIA+ENPVVRAAKL+KV Sbjct: 104 FCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKLVKV 143 >gb|KZV48851.1| hypothetical protein F511_24710 [Dorcoceras hygrometricum] Length = 140 Score = 84.0 bits (206), Expect = 9e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 VFC EHRYSDRHDCSYDYKAAGREAIA+ENPVVRA+KLLKV Sbjct: 100 VFCPEHRYSDRHDCSYDYKAAGREAIARENPVVRASKLLKV 140 >gb|EPS66139.1| hypothetical protein M569_08638, partial [Genlisea aurea] Length = 76 Score = 82.0 bits (201), Expect = 9e-18 Identities = 35/41 (85%), Positives = 41/41 (100%) Frame = +3 Query: 3 VFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVRAAKLLKV 125 +FCSEHRYSDRHDCSYDYKAAGRE+IA+ENPV++A+KLLKV Sbjct: 36 LFCSEHRYSDRHDCSYDYKAAGRESIARENPVIKASKLLKV 76