BLASTX nr result
ID: Rehmannia30_contig00012371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00012371 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99838.1| hypothetical protein CDL12_27663 [Handroanthus im... 66 7e-12 gb|EYU37911.1| hypothetical protein MIMGU_mgv1a017615mg [Erythra... 65 1e-11 ref|XP_011088539.1| uncharacterized protein LOC105169741 [Sesamu... 64 4e-11 gb|OIW05659.1| hypothetical protein TanjilG_23445 [Lupinus angus... 59 3e-09 ref|XP_012073836.1| uncharacterized protein LOC105635370 isoform... 59 3e-09 ref|XP_022876197.1| uncharacterized protein LOC111394562 [Olea e... 59 4e-09 ref|XP_022132454.1| uncharacterized protein LOC111005275 [Momord... 59 4e-09 ref|XP_021692694.1| uncharacterized protein LOC110673801 [Hevea ... 59 4e-09 ref|XP_023900289.1| uncharacterized protein LOC112012136 [Quercu... 58 7e-09 gb|ABK94588.1| unknown [Populus trichocarpa] >gi|1334323344|gb|P... 58 7e-09 gb|PIN14270.1| hypothetical protein CDL12_13092 [Handroanthus im... 58 1e-08 gb|OMO74418.1| hypothetical protein CCACVL1_16743 [Corchorus cap... 58 1e-08 ref|XP_014524310.1| uncharacterized protein LOC106780522 [Vigna ... 57 1e-08 ref|XP_012833739.1| PREDICTED: uncharacterized protein LOC105954... 57 1e-08 ref|XP_024166183.1| uncharacterized protein LOC112172914 [Rosa c... 57 2e-08 ref|XP_022136306.1| uncharacterized protein LOC111008022 [Momord... 57 2e-08 ref|XP_015892295.1| PREDICTED: uncharacterized protein LOC107426... 57 2e-08 ref|XP_022974819.1| uncharacterized protein LOC111473599 [Cucurb... 57 3e-08 ref|XP_022896748.1| uncharacterized protein LOC111410567 [Olea e... 57 3e-08 ref|XP_022725264.1| uncharacterized protein LOC111281821 [Durio ... 57 3e-08 >gb|PIM99838.1| hypothetical protein CDL12_27663 [Handroanthus impetiginosus] Length = 53 Score = 65.9 bits (159), Expect = 7e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGSVKLK+LKAQAKSHKKAEAKGHH Sbjct: 22 AFSFGLVYGSVKLKILKAQAKSHKKAEAKGHH 53 >gb|EYU37911.1| hypothetical protein MIMGU_mgv1a017615mg [Erythranthe guttata] Length = 53 Score = 65.5 bits (158), Expect = 1e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFGIVYGSVKL++LKAQAKSHKKAEAKGHH Sbjct: 22 AFSFGIVYGSVKLRILKAQAKSHKKAEAKGHH 53 >ref|XP_011088539.1| uncharacterized protein LOC105169741 [Sesamum indicum] Length = 53 Score = 63.9 bits (154), Expect = 4e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGSVKLK+LK QAKSHKKAEAKGHH Sbjct: 22 AFSFGLVYGSVKLKILKMQAKSHKKAEAKGHH 53 >gb|OIW05659.1| hypothetical protein TanjilG_23445 [Lupinus angustifolius] Length = 53 Score = 59.3 bits (142), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGS+KLKVLKA+AKSH KAEAK HH Sbjct: 22 AFSFGLVYGSLKLKVLKAKAKSHNKAEAKAHH 53 >ref|XP_012073836.1| uncharacterized protein LOC105635370 isoform X1 [Jatropha curcas] Length = 53 Score = 59.3 bits (142), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGSVKLKVLK +AKSHKK+EAK HH Sbjct: 22 AFSFGLVYGSVKLKVLKMKAKSHKKSEAKAHH 53 >ref|XP_022876197.1| uncharacterized protein LOC111394562 [Olea europaea var. sylvestris] Length = 53 Score = 58.9 bits (141), Expect = 4e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYG++KLK+LKA+AKSHKKAEAK HH Sbjct: 22 AFSFGLVYGNMKLKILKAKAKSHKKAEAKTHH 53 >ref|XP_022132454.1| uncharacterized protein LOC111005275 [Momordica charantia] Length = 53 Score = 58.9 bits (141), Expect = 4e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AF+FG+VYGS+KLKVLKA+AKSH KAEAK HH Sbjct: 22 AFTFGVVYGSIKLKVLKAKAKSHAKAEAKAHH 53 >ref|XP_021692694.1| uncharacterized protein LOC110673801 [Hevea brasiliensis] Length = 53 Score = 58.9 bits (141), Expect = 4e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGSVKLK+LK +AKSHKK+EAK HH Sbjct: 22 AFSFGLVYGSVKLKILKMKAKSHKKSEAKAHH 53 >ref|XP_023900289.1| uncharacterized protein LOC112012136 [Quercus suber] Length = 53 Score = 58.2 bits (139), Expect = 7e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AF+FG+VYG +KLKVLKA+AK+HKKAEAK HH Sbjct: 22 AFTFGVVYGGIKLKVLKAKAKAHKKAEAKDHH 53 >gb|ABK94588.1| unknown [Populus trichocarpa] gb|PNT38389.1| hypothetical protein POPTR_005G236500v3 [Populus trichocarpa] Length = 53 Score = 58.2 bits (139), Expect = 7e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGSVKLK+LK +A SHKKAEAK HH Sbjct: 22 AFSFGLVYGSVKLKILKMKANSHKKAEAKAHH 53 >gb|PIN14270.1| hypothetical protein CDL12_13092 [Handroanthus impetiginosus] Length = 53 Score = 57.8 bits (138), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AF+ G+VYGSVKLKVLKA+AKS KKAEAKGHH Sbjct: 22 AFTVGLVYGSVKLKVLKAKAKSQKKAEAKGHH 53 >gb|OMO74418.1| hypothetical protein CCACVL1_16743 [Corchorus capsularis] gb|OMP03118.1| ATPase, F0 complex, subunit E, mitochondrial [Corchorus olitorius] Length = 53 Score = 57.8 bits (138), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFGIVYGS+KLK LKA+AKS KKAEAK HH Sbjct: 22 AFSFGIVYGSIKLKYLKAKAKSQKKAEAKAHH 53 >ref|XP_014524310.1| uncharacterized protein LOC106780522 [Vigna radiata var. radiata] ref|XP_017432364.1| PREDICTED: uncharacterized protein LOC108339688 [Vigna angularis] Length = 53 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGS+KLK LKA+AKSHKKA+ K HH Sbjct: 22 AFSFGVVYGSIKLKYLKAKAKSHKKAQEKAHH 53 >ref|XP_012833739.1| PREDICTED: uncharacterized protein LOC105954621 [Erythranthe guttata] Length = 53 Score = 57.4 bits (137), Expect = 1e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AF+FG+ YGSVKLKVLKA+AKS KK EAKGHH Sbjct: 22 AFTFGLAYGSVKLKVLKAKAKSQKKVEAKGHH 53 >ref|XP_024166183.1| uncharacterized protein LOC112172914 [Rosa chinensis] gb|PRQ24088.1| putative ATP synthase, F0 complex, subunit E [Rosa chinensis] Length = 53 Score = 57.0 bits (136), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFS G+VYGS+KL+VLKA+AKSH+KAEAK HH Sbjct: 22 AFSLGLVYGSIKLRVLKAKAKSHQKAEAKAHH 53 >ref|XP_022136306.1| uncharacterized protein LOC111008022 [Momordica charantia] Length = 53 Score = 57.0 bits (136), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGS KLK L+A+AKSHKKAEAK HH Sbjct: 22 AFSFGLVYGSFKLKYLQAKAKSHKKAEAKAHH 53 >ref|XP_015892295.1| PREDICTED: uncharacterized protein LOC107426588 [Ziziphus jujuba] Length = 53 Score = 57.0 bits (136), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGS+KLK LKA+AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSIKLKYLKAKAKSQKKAEAKAHH 53 >ref|XP_022974819.1| uncharacterized protein LOC111473599 [Cucurbita maxima] Length = 53 Score = 56.6 bits (135), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AF+FG+VYG++KLKVLKA+AKSH KAEAK HH Sbjct: 22 AFTFGLVYGNIKLKVLKAKAKSHAKAEAKTHH 53 >ref|XP_022896748.1| uncharacterized protein LOC111410567 [Olea europaea var. sylvestris] Length = 53 Score = 56.6 bits (135), Expect = 3e-08 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFS G++YG++KLK+L+A+AKSHKKAE KGHH Sbjct: 22 AFSLGLIYGNMKLKILRAKAKSHKKAEVKGHH 53 >ref|XP_022725264.1| uncharacterized protein LOC111281821 [Durio zibethinus] Length = 53 Score = 56.6 bits (135), Expect = 3e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 AFSFGIVYGSVKLKVLKAQAKSHKKAEAKGHH 98 AFSFG+VYGSVKLK LKA AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSVKLKYLKATAKSQKKAEAKSHH 53