BLASTX nr result
ID: Rehmannia30_contig00012370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00012370 (523 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM98980.1| U1 snRNP-specific protein C [Handroanthus impetig... 60 6e-08 ref|XP_011082507.1| U1 small nuclear ribonucleoprotein C [Sesamu... 56 2e-06 >gb|PIM98980.1| U1 snRNP-specific protein C [Handroanthus impetiginosus] Length = 192 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 GGPPMFAPAMYQGNVSSLPTSGGSDGSNINAQAPEA 110 G PPMFAP MYQG+ + LPTSGGSDG NINAQAPEA Sbjct: 156 GAPPMFAPPMYQGS-APLPTSGGSDGVNINAQAPEA 190 >ref|XP_011082507.1| U1 small nuclear ribonucleoprotein C [Sesamum indicum] Length = 194 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 GGPPMFAPAMYQGNVSSLPTSGGSDGSNINAQAPEA 110 G PPMFAP +YQG+VS LP+SGG DG+N +AQAPEA Sbjct: 158 GAPPMFAPPVYQGSVS-LPSSGGGDGTNASAQAPEA 192