BLASTX nr result
ID: Rehmannia30_contig00011885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00011885 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076560.1| uncharacterized protein LOC105160776 [Sesamu... 81 1e-14 ref|XP_016575672.1| PREDICTED: uncharacterized protein LOC107873... 80 2e-14 ref|XP_015080249.1| PREDICTED: uncharacterized protein LOC107023... 80 2e-14 gb|PHU14127.1| hypothetical protein BC332_15332 [Capsicum chinense] 80 2e-14 gb|PHT44991.1| hypothetical protein CQW23_14149 [Capsicum baccatum] 80 2e-14 ref|XP_016575671.1| PREDICTED: uncharacterized protein LOC107873... 80 2e-14 ref|XP_015080247.1| PREDICTED: uncharacterized protein LOC107023... 80 2e-14 ref|XP_006357306.1| PREDICTED: uncharacterized protein LOC102585... 80 2e-14 ref|XP_004240838.1| PREDICTED: uncharacterized protein LOC101246... 80 2e-14 ref|XP_016575670.1| PREDICTED: uncharacterized protein LOC107873... 80 2e-14 ref|XP_019238643.1| PREDICTED: uncharacterized protein LOC109218... 77 2e-13 ref|XP_009759160.1| PREDICTED: uncharacterized protein LOC104211... 77 2e-13 ref|XP_009607286.1| PREDICTED: uncharacterized protein LOC104101... 77 2e-13 ref|XP_022868461.1| uncharacterized protein LOC111387866 isoform... 77 2e-13 ref|XP_022868394.1| uncharacterized protein LOC111387866 isoform... 77 2e-13 ref|XP_022868327.1| uncharacterized protein LOC111387866 isoform... 77 2e-13 ref|XP_012858612.1| PREDICTED: uncharacterized protein LOC105977... 77 2e-13 ref|XP_022868256.1| uncharacterized protein LOC111387866 isoform... 77 2e-13 gb|KVI04346.1| hypothetical protein Ccrd_017343 [Cynara carduncu... 76 4e-13 emb|CDP13869.1| unnamed protein product [Coffea canephora] 76 4e-13 >ref|XP_011076560.1| uncharacterized protein LOC105160776 [Sesamum indicum] Length = 477 Score = 80.9 bits (198), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 37 >ref|XP_016575672.1| PREDICTED: uncharacterized protein LOC107873358 isoform X3 [Capsicum annuum] Length = 461 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_015080249.1| PREDICTED: uncharacterized protein LOC107023918 isoform X2 [Solanum pennellii] Length = 479 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >gb|PHU14127.1| hypothetical protein BC332_15332 [Capsicum chinense] Length = 480 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >gb|PHT44991.1| hypothetical protein CQW23_14149 [Capsicum baccatum] Length = 480 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_016575671.1| PREDICTED: uncharacterized protein LOC107873358 isoform X2 [Capsicum annuum] gb|PHT78296.1| hypothetical protein T459_16348 [Capsicum annuum] Length = 480 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_015080247.1| PREDICTED: uncharacterized protein LOC107023918 isoform X1 [Solanum pennellii] ref|XP_015080248.1| PREDICTED: uncharacterized protein LOC107023918 isoform X1 [Solanum pennellii] Length = 480 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_006357306.1| PREDICTED: uncharacterized protein LOC102585852 [Solanum tuberosum] ref|XP_006357307.1| PREDICTED: uncharacterized protein LOC102585852 [Solanum tuberosum] Length = 480 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_004240838.1| PREDICTED: uncharacterized protein LOC101246351 isoform X1 [Solanum lycopersicum] Length = 480 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_016575670.1| PREDICTED: uncharacterized protein LOC107873358 isoform X1 [Capsicum annuum] Length = 481 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKK 37 >ref|XP_019238643.1| PREDICTED: uncharacterized protein LOC109218725 [Nicotiana attenuata] gb|OIT21588.1| hypothetical protein A4A49_35661 [Nicotiana attenuata] Length = 474 Score = 77.4 bits (189), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRI ASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRICASPRPCCGRRVVAKKRPRGGVDGFVNSVKK 37 >ref|XP_009759160.1| PREDICTED: uncharacterized protein LOC104211756 [Nicotiana sylvestris] ref|XP_016457524.1| PREDICTED: uncharacterized protein LOC107781344 [Nicotiana tabacum] Length = 478 Score = 77.4 bits (189), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRI ASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRICASPRPCCGRRVVAKKRPRGGVDGFVNSVKK 37 >ref|XP_009607286.1| PREDICTED: uncharacterized protein LOC104101522 [Nicotiana tomentosiformis] ref|XP_016449097.1| PREDICTED: uncharacterized protein LOC107774135 [Nicotiana tabacum] Length = 478 Score = 77.4 bits (189), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRI ASPRPCCGRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRICASPRPCCGRRVVAKKRPRGGVDGFVNSVKK 37 >ref|XP_022868461.1| uncharacterized protein LOC111387866 isoform X4 [Olea europaea var. sylvestris] Length = 450 Score = 77.0 bits (188), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGGLDGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKK 37 >ref|XP_022868394.1| uncharacterized protein LOC111387866 isoform X3 [Olea europaea var. sylvestris] Length = 464 Score = 77.0 bits (188), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGGLDGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKK 37 >ref|XP_022868327.1| uncharacterized protein LOC111387866 isoform X2 [Olea europaea var. sylvestris] Length = 477 Score = 77.0 bits (188), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGGLDGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKK 37 >ref|XP_012858612.1| PREDICTED: uncharacterized protein LOC105977781 [Erythranthe guttata] gb|EYU20143.1| hypothetical protein MIMGU_mgv1a005588mg [Erythranthe guttata] Length = 478 Score = 77.0 bits (188), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGGLDGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKK 37 >ref|XP_022868256.1| uncharacterized protein LOC111387866 isoform X1 [Olea europaea var. sylvestris] Length = 491 Score = 77.0 bits (188), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGGLDGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKK 37 >gb|KVI04346.1| hypothetical protein Ccrd_017343 [Cynara cardunculus var. scolymus] Length = 448 Score = 76.3 bits (186), Expect = 4e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGIDGFVNSVKK 37 >emb|CDP13869.1| unnamed protein product [Coffea canephora] Length = 477 Score = 76.3 bits (186), Expect = 4e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 383 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKK 493 MDGRRITASPRPC GRRVVAKKRPRGG+DGFVNSVKK Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGMDGFVNSVKK 37