BLASTX nr result
ID: Rehmannia30_contig00011515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00011515 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO76903.1| hypothetical protein CISIN_1g035461mg [Citrus sin... 69 1e-12 ref|XP_023879483.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_020677910.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_020593710.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_020244053.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 dbj|GAU40131.1| hypothetical protein TSUD_163000 [Trifolium subt... 69 2e-12 ref|XP_017256911.1| PREDICTED: DNA-directed RNA polymerases II, ... 69 2e-12 ref|XP_017248690.1| PREDICTED: DNA-directed RNA polymerases II, ... 69 2e-12 ref|XP_015965327.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_015958471.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_011082823.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_008812669.1| PREDICTED: DNA-directed RNA polymerases II, ... 69 2e-12 ref|XP_010662206.1| PREDICTED: DNA-directed RNA polymerases II, ... 69 2e-12 ref|XP_003534102.1| PREDICTED: DNA-directed RNA polymerases II, ... 69 2e-12 ref|XP_020524913.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_020110017.1| DNA-directed RNA polymerases II, IV and V su... 69 2e-12 ref|XP_016457501.1| PREDICTED: DNA-directed RNA polymerases II, ... 69 2e-12 ref|NP_001278509.1| uncharacterized protein LOC100285004 [Zea ma... 69 2e-12 gb|ABK22384.1| unknown [Picea sitchensis] >gi|116790944|gb|ABK25... 69 2e-12 gb|ABK21111.1| unknown [Picea sitchensis] 69 2e-12 >gb|KDO76903.1| hypothetical protein CISIN_1g035461mg [Citrus sinensis] Length = 35 Score = 68.6 bits (166), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 5 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 35 >ref|XP_023879483.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Quercus suber] ref|XP_023926840.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Quercus suber] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_020677910.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Dendrobium catenatum] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_020593710.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Phalaenopsis equestris] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_020244053.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Asparagus officinalis] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >dbj|GAU40131.1| hypothetical protein TSUD_163000 [Trifolium subterraneum] gb|PNX77941.1| DNA-directed RNA polymerases I, II, and III subunit RPABC1 [Trifolium pratense] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_017256911.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12-like [Daucus carota subsp. sativus] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_017248690.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Daucus carota subsp. sativus] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_015965327.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Arachis duranensis] ref|XP_016189354.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Arachis ipaensis] ref|XP_016202598.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Arachis ipaensis] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_015958471.1| DNA-directed RNA polymerases II, IV and V subunit 12 isoform X2 [Arachis duranensis] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_011082823.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Sesamum indicum] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_008812669.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Phoenix dactylifera] ref|XP_019705338.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Elaeis guineensis] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_010662206.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Vitis vinifera] ref|XP_011098141.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Sesamum indicum] ref|XP_019105134.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Beta vulgaris subsp. vulgaris] ref|XP_021766210.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Chenopodium quinoa] ref|XP_021770982.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Chenopodium quinoa] ref|XP_021859905.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Spinacia oleracea] ref|XP_022848539.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Olea europaea var. sylvestris] ref|XP_022877695.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Olea europaea var. sylvestris] emb|CBI27346.3| unnamed protein product, partial [Vitis vinifera] gb|KMT11289.1| hypothetical protein BVRB_5g109730 [Beta vulgaris subsp. vulgaris] gb|KNA18575.1| hypothetical protein SOVF_069460 [Spinacia oleracea] gb|PIN02973.1| DNA-directed RNA polymerase, subunit RPB7.0 [Handroanthus impetiginosus] gb|PIN12781.1| DNA-directed RNA polymerase, subunit RPB7.0 [Handroanthus impetiginosus] gb|PIN14409.1| DNA-directed RNA polymerase, subunit RPB7.0 [Handroanthus impetiginosus] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_003534102.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Glycine max] ref|XP_003548293.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Glycine max] ref|XP_006448405.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Citrus clementina] ref|XP_007152540.1| hypothetical protein PHAVU_004G138700g [Phaseolus vulgaris] ref|XP_010265372.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nelumbo nucifera] ref|XP_010279451.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nelumbo nucifera] ref|XP_010279452.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nelumbo nucifera] ref|XP_012093117.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Jatropha curcas] ref|XP_017439147.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Vigna angularis] ref|XP_018849286.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Juglans regia] ref|XP_018827042.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Juglans regia] ref|XP_020212630.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Cajanus cajan] ref|XP_020532481.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Jatropha curcas] ref|XP_024022128.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Morus notabilis] ref|XP_024022129.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Morus notabilis] gb|ACU15492.1| unknown [Glycine max] gb|ESR61645.1| hypothetical protein CICLE_v10017429mg [Citrus clementina] gb|ESW24534.1| hypothetical protein PHAVU_004G138700g [Phaseolus vulgaris] gb|KDO76902.1| hypothetical protein CISIN_1g035461mg [Citrus sinensis] gb|KHN24498.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Glycine soja] gb|KRH09382.1| hypothetical protein GLYMA_16G212700 [Glycine max] gb|KRH38875.1| hypothetical protein GLYMA_09G164200 [Glycine max] dbj|BAU02571.1| hypothetical protein VIGAN_11212200 [Vigna angularis var. angularis] gb|OAY39281.1| hypothetical protein MANES_10G081900 [Manihot esculenta] gb|OIV97068.1| hypothetical protein TanjilG_14613 [Lupinus angustifolius] gb|OVA05531.1| RNA polymerase archaeal subunit P/eukaryotic subunit RPC10 [Macleaya cordata] Length = 51 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 21 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 51 >ref|XP_020524913.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Amborella trichopoda] ref|XP_020524914.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Amborella trichopoda] ref|XP_020524915.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Amborella trichopoda] ref|XP_020524916.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Amborella trichopoda] ref|XP_020524917.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Amborella trichopoda] ref|XP_020524918.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Amborella trichopoda] Length = 52 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 22 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 52 >ref|XP_020110017.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Ananas comosus] Length = 52 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 22 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 52 >ref|XP_016457501.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nicotiana tabacum] ref|XP_016515113.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nicotiana tabacum] ref|XP_016545536.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Capsicum annuum] ref|XP_018634509.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nicotiana tomentosiformis] ref|XP_019226352.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Nicotiana attenuata] gb|PHT35548.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Capsicum baccatum] gb|PHT69660.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Capsicum annuum] gb|PHU04194.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Capsicum chinense] Length = 52 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 22 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 52 >ref|NP_001278509.1| uncharacterized protein LOC100285004 [Zea mays] ref|XP_002461922.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Sorghum bicolor] ref|XP_002443988.1| DNA-directed RNA polymerases II, IV and V subunit 12 [Sorghum bicolor] ref|XP_015626385.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Oryza sativa Japonica Group] ref|XP_015638231.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Oryza sativa Japonica Group] gb|ACG26759.1| DNA-directed RNA polymerases I, II, and III 7.3 kDa polypeptide [Zea mays] gb|ACG32317.1| DNA-directed RNA polymerases I, II, and III 7.3 kDa polypeptide [Zea mays] gb|ACG42358.1| DNA-directed RNA polymerases I, II, and III 7.3 kDa polypeptide [Zea mays] gb|ACG42591.1| DNA-directed RNA polymerases I, II, and III 7.3 kDa polypeptide [Zea mays] gb|EEC70807.1| hypothetical protein OsI_02267 [Oryza sativa Indica Group] gb|EEE54727.1| hypothetical protein OsJ_02072 [Oryza sativa Japonica Group] gb|EES13483.1| hypothetical protein SORBI_3007G068800 [Sorghum bicolor] dbj|BAH91121.1| Os01g0530366 [Oryza sativa Japonica Group] dbj|BAH92949.1| Os05g0151800 [Oryza sativa Japonica Group] dbj|BAS72504.1| Os01g0530366 [Oryza sativa Japonica Group] gb|KQL23458.1| hypothetical protein SETIT_031842mg [Setaria italica] gb|PAN10766.1| hypothetical protein PAHAL_B01648 [Panicum hallii] Length = 52 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 22 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 52 >gb|ABK22384.1| unknown [Picea sitchensis] gb|ABK25799.1| unknown [Picea sitchensis] gb|ABR18025.1| unknown [Picea sitchensis] gb|ACN40214.1| unknown [Picea sitchensis] gb|ACN40753.1| unknown [Picea sitchensis] Length = 53 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 23 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 53 >gb|ABK21111.1| unknown [Picea sitchensis] Length = 53 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 507 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 415 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR Sbjct: 23 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR 53