BLASTX nr result
ID: Rehmannia30_contig00010352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00010352 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086392.1| mitochondrial outer membrane protein porin o... 95 8e-21 gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [... 89 2e-20 ref|XP_012847717.1| PREDICTED: mitochondrial outer membrane prot... 93 3e-20 ref|XP_022889050.1| mitochondrial outer membrane protein porin o... 92 8e-20 emb|CDP00287.1| unnamed protein product [Coffea canephora] 92 8e-20 emb|CDP00288.1| unnamed protein product [Coffea canephora] 91 2e-19 ref|XP_022776944.1| mitochondrial outer membrane protein porin o... 91 2e-19 ref|XP_022776943.1| mitochondrial outer membrane protein porin o... 91 3e-19 gb|OVA00303.1| Eukaryotic porin/Tom40 [Macleaya cordata] 90 5e-19 ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane prot... 90 5e-19 gb|PIM97188.1| Porin/voltage-dependent anion-selective channel p... 90 5e-19 ref|XP_019232966.1| PREDICTED: mitochondrial outer membrane prot... 90 6e-19 ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane prot... 90 6e-19 ref|XP_011071026.1| mitochondrial outer membrane protein porin o... 90 7e-19 gb|OWM74673.1| hypothetical protein CDL15_Pgr016284 [Punica gran... 89 7e-19 gb|OMP12225.1| hypothetical protein CCACVL1_00070 [Corchorus cap... 89 9e-19 ref|XP_016580577.1| PREDICTED: mitochondrial outer membrane prot... 89 9e-19 emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] 89 9e-19 ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane prot... 89 9e-19 ref|NP_001275134.1| mitochondrial outer membrane protein porin o... 89 9e-19 >ref|XP_011086392.1| mitochondrial outer membrane protein porin of 36 kDa [Sesamum indicum] Length = 278 Score = 94.7 bits (234), Expect = 8e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP Sbjct: 232 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 278 >gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis] gb|KDO82797.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis] Length = 101 Score = 89.0 bits (219), Expect = 2e-20 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYG+ SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLA+ALKP Sbjct: 55 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 101 >ref|XP_012847717.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Erythranthe guttata] gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata] Length = 278 Score = 93.2 bits (230), Expect = 3e-20 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGK SALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP Sbjct: 232 RVNNYGKASALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 278 >ref|XP_022889050.1| mitochondrial outer membrane protein porin of 36 kDa-like, partial [Olea europaea var. sylvestris] Length = 273 Score = 92.0 bits (227), Expect = 8e-20 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGKVSALIQH+WRPKS++TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 227 RVNNYGKVSALIQHQWRPKSIVTISGEVDTRAIEKSAKIGLAVALKP 273 >emb|CDP00287.1| unnamed protein product [Coffea canephora] Length = 276 Score = 92.0 bits (227), Expect = 8e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGK SALIQHEWRPKSL+TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNNYGKASALIQHEWRPKSLLTISGEVDTRAIEKSAKIGLAVALKP 276 >emb|CDP00288.1| unnamed protein product [Coffea canephora] Length = 276 Score = 91.3 bits (225), Expect = 2e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGK SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_022776944.1| mitochondrial outer membrane protein porin of 36 kDa-like isoform X2 [Durio zibethinus] Length = 239 Score = 90.5 bits (223), Expect = 2e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGK SALIQHEWRPKSL TISGEVDTRAIEKSAKVGLA+ALKP Sbjct: 193 RVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 239 >ref|XP_022776943.1| mitochondrial outer membrane protein porin of 36 kDa-like isoform X1 [Durio zibethinus] Length = 276 Score = 90.5 bits (223), Expect = 3e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYGK SALIQHEWRPKSL TISGEVDTRAIEKSAKVGLA+ALKP Sbjct: 230 RVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >gb|OVA00303.1| Eukaryotic porin/Tom40 [Macleaya cordata] Length = 276 Score = 90.1 bits (222), Expect = 5e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 R+NNYGK SALIQHEWRPKSL TISGEVDTRAIEKSAKVGLA+ALKP Sbjct: 230 RINNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nelumbo nucifera] Length = 276 Score = 90.1 bits (222), Expect = 5e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 R+NNYGK SALIQHEWRPKSL+TISGEVDTRAIEKSAKVGLA+ALKP Sbjct: 230 RLNNYGKASALIQHEWRPKSLLTISGEVDTRAIEKSAKVGLALALKP 276 >gb|PIM97188.1| Porin/voltage-dependent anion-selective channel protein [Handroanthus impetiginosus] Length = 278 Score = 90.1 bits (222), Expect = 5e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNN+GK SALIQHEWRPKSLITISGEVDTRAIEKSAKVGLA+ALKP Sbjct: 232 RVNNHGKASALIQHEWRPKSLITISGEVDTRAIEKSAKVGLALALKP 278 >ref|XP_019232966.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nicotiana attenuata] gb|OIT27697.1| mitochondrial outer membrane protein porin of 36 kda [Nicotiana attenuata] Length = 276 Score = 89.7 bits (221), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVN+YGK SALIQHEWRPKSL TISGEVDTRAIEKSAKVGLAVALKP Sbjct: 230 RVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVALKP 276 >ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nicotiana sylvestris] ref|XP_016506735.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nicotiana tabacum] Length = 276 Score = 89.7 bits (221), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVN+YGK SALIQHEWRPKSL TISGEVDTRAIEKSAKVGLAVALKP Sbjct: 230 RVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVALKP 276 >ref|XP_011071026.1| mitochondrial outer membrane protein porin of 36 kDa-like [Sesamum indicum] Length = 278 Score = 89.7 bits (221), Expect = 7e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNN+G+ SALIQHEWRPKSLITISGEVDTRAIEKSAK+GLAVALKP Sbjct: 232 RVNNHGRASALIQHEWRPKSLITISGEVDTRAIEKSAKIGLAVALKP 278 >gb|OWM74673.1| hypothetical protein CDL15_Pgr016284 [Punica granatum] Length = 244 Score = 89.0 bits (219), Expect = 7e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYG+ SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLA+ALKP Sbjct: 198 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 244 >gb|OMP12225.1| hypothetical protein CCACVL1_00070 [Corchorus capsularis] Length = 276 Score = 89.4 bits (220), Expect = 9e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVNNYG+ SAL+QHEWRPKSL TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNNYGRASALLQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_016580577.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Capsicum annuum] gb|PHT59480.1| Mitochondrial outer membrane protein porin of 36 kDa [Capsicum baccatum] gb|PHT94040.1| Mitochondrial outer membrane protein porin 1 [Capsicum annuum] gb|PHU15970.1| Mitochondrial outer membrane protein porin of 36 kDa [Capsicum chinense] Length = 276 Score = 89.4 bits (220), Expect = 9e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVN+YGK SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] Length = 276 Score = 89.4 bits (220), Expect = 9e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVN+YGK SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Solanum lycopersicum] ref|XP_015062174.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Solanum pennellii] Length = 276 Score = 89.4 bits (220), Expect = 9e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVN+YGK SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum tuberosum] sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 89.4 bits (220), Expect = 9e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 RVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 141 RVN+YGK SALIQHEWRPKSL TISGEVDTRAIEKSAK+GLAVALKP Sbjct: 230 RVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276