BLASTX nr result
ID: Rehmannia30_contig00010135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00010135 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV13985.1| hypothetical protein F511_44661 [Dorcoceras hygro... 56 9e-06 >gb|KZV13985.1| hypothetical protein F511_44661 [Dorcoceras hygrometricum] Length = 623 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/70 (37%), Positives = 37/70 (52%) Frame = -2 Query: 212 AGALSHHSEDDNKLSAAFLSFWIDRQKLHKEVHNNSKCCRFIRDLQASDGTRGPYALING 33 A ALS E+ +L+ L W + + VH + K ++DL GPY LING Sbjct: 314 ADALSRRQEEQTELTGISLPVWAEHDAIKDAVHKDPKLRNIVQDLSKETRKEGPYTLING 373 Query: 32 VLFYKGRIVL 3 VL +KGR+V+ Sbjct: 374 VLLHKGRVVV 383