BLASTX nr result
ID: Rehmannia30_contig00010065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00010065 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073570.1| uncharacterized protein LOC105158483 [Sesamu... 68 5e-12 gb|PIN17918.1| hypothetical protein CDL12_09418 [Handroanthus im... 66 3e-11 gb|PIN11533.1| hypothetical protein CDL12_15858 [Handroanthus im... 59 3e-08 ref|XP_012842888.1| PREDICTED: uncharacterized protein LOC105963... 58 4e-08 ref|XP_022885083.1| uncharacterized protein LOC111401535 isoform... 54 2e-06 >ref|XP_011073570.1| uncharacterized protein LOC105158483 [Sesamum indicum] Length = 95 Score = 68.2 bits (165), Expect = 5e-12 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -1 Query: 167 MDMNHNGLKIDVCNNGVNSLESPKVVMIEESDVDDESQALLASENGGLTKGSEK 6 MD NH G+KID NNG ++L+SP VV+IEES DDESQALL+ ++ GL+K SEK Sbjct: 1 MDTNHKGVKIDRSNNGFSNLKSPAVVVIEESGRDDESQALLSFQDVGLSKDSEK 54 >gb|PIN17918.1| hypothetical protein CDL12_09418 [Handroanthus impetiginosus] Length = 92 Score = 66.2 bits (160), Expect = 3e-11 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = -1 Query: 167 MDMNHNGLKIDVCNNGVNSLESPKVVMIEESDVDDESQALLASENGGLTKGSEKP 3 MD NH G+KID NN LESPKVVMIEESD +DESQALL S+ G L+ EKP Sbjct: 1 MDKNHKGVKIDEINN----LESPKVVMIEESDGEDESQALLPSDKGELSTKPEKP 51 >gb|PIN11533.1| hypothetical protein CDL12_15858 [Handroanthus impetiginosus] Length = 96 Score = 58.5 bits (140), Expect = 3e-08 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -1 Query: 167 MDMNHNGLKIDVCNNGVNSLESPKVVMIEESDVDDESQALLASENGGLTKGSEKP 3 MDMNH+ L DV N +N +ESPK V+ E D DDES++LL S+ L + SEKP Sbjct: 1 MDMNHSSLNSDVSKNDLNGVESPKAVVNGEGDGDDESKSLLHSQENKLLQESEKP 55 >ref|XP_012842888.1| PREDICTED: uncharacterized protein LOC105963068 [Erythranthe guttata] gb|EYU32576.1| hypothetical protein MIMGU_mgv1a017067mg [Erythranthe guttata] Length = 95 Score = 58.2 bits (139), Expect = 4e-08 Identities = 32/51 (62%), Positives = 41/51 (80%), Gaps = 3/51 (5%) Frame = -1 Query: 146 LKIDVCNNGVNS-LESPKVVMIEES--DVDDESQALLASENGGLTKGSEKP 3 + ID + +NS LESPKV+++EES DV+DES+ALL SENGGL+K SEKP Sbjct: 3 INIDAISGSMNSILESPKVMIMEESESDVEDESRALLQSENGGLSKKSEKP 53 >ref|XP_022885083.1| uncharacterized protein LOC111401535 isoform X1 [Olea europaea var. sylvestris] Length = 97 Score = 53.5 bits (127), Expect = 2e-06 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -1 Query: 167 MDMNHNGLKIDVCN-NGVNSLESPKVVMIEESDVDDESQALLASENGGLTKGSEKP 3 MDMN +K N N VNS+ESPKV++ EE + DDES+ LL S+ GGL+K KP Sbjct: 1 MDMNGKDVKNHKNNTNIVNSVESPKVILNEEIEGDDESRTLLPSKKGGLSKNKGKP 56