BLASTX nr result
ID: Rehmannia30_contig00010057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00010057 (904 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835211.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 58 7e-06 gb|POE87067.1| isoform 2 of 4-hydroxy-tetrahydrodipicolinate syn... 54 8e-06 >ref|XP_012835211.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like isoform X1 [Erythranthe guttata] ref|XP_012835212.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like isoform X2 [Erythranthe guttata] gb|EYU39172.1| hypothetical protein MIMGU_mgv1a009139mg [Erythranthe guttata] Length = 352 Score = 58.2 bits (139), Expect = 7e-06 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -1 Query: 904 KWRSPRAAVIPNFHLPMRSYEVKNR*SFEQF-LLKVIASV 788 KWRSPRAAVIPNFHLPMRSYEVKNR + ++ L++I ++ Sbjct: 20 KWRSPRAAVIPNFHLPMRSYEVKNRTNVDEIKALRLITAI 59 >gb|POE87067.1| isoform 2 of 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic [Quercus suber] Length = 77 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -1 Query: 904 KWRSPRAAVIPNFHLPMRSYEVKNR*SFEQF-LLKVIASV 788 KWRSP+AAVIPNFHLPMRS EVKNR S + L++I ++ Sbjct: 29 KWRSPQAAVIPNFHLPMRSLEVKNRTSTDDIKALRLITAI 68