BLASTX nr result
ID: Rehmannia30_contig00009845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00009845 (826 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OWK25792.1| hypothetical protein AJ87_01125 [Rhizobium yangli... 132 3e-34 ref|YP_009354249.1| ycf2 (chloroplast) [Rehmannia piasezkii] >gi... 141 3e-34 ref|YP_009344480.1| ycf2 (chloroplast) [Rehmannia chingii] >gi|1... 141 3e-34 gb|PHT68413.1| hypothetical protein T459_27900 [Capsicum annuum] 129 7e-34 ref|YP_009462474.1| Ycf2 protein (chloroplast) [Syringa vulgaris... 140 1e-33 ref|YP_009462210.1| Ycf2 protein (chloroplast) [Noronhia lowryi]... 140 1e-33 gb|AUT84358.1| Ycf2 protein (chloroplast) [Fraxinus ornus] >gi|1... 140 1e-33 gb|AUT84097.1| Ycf2 protein (chloroplast) [Fontanesia phillyreoi... 140 1e-33 ref|YP_009462122.1| Ycf2 protein (chloroplast) [Nestegis apetala... 140 1e-33 ref|YP_009462035.1| Ycf2 protein (chloroplast) [Forsythia x inte... 140 1e-33 ref|YP_009461859.1| Ycf2 protein (chloroplast) [Chionanthus rupi... 140 1e-33 ref|YP_009461771.1| Ycf2 protein (chloroplast) [Chionanthus park... 140 1e-33 ref|YP_009110644.1| Ycf2 protein (chloroplast) [Hesperelaea palm... 140 1e-33 ref|YP_004564046.1| Ycf2 protein [Olea woodiana subsp. woodiana]... 140 1e-33 emb|CBR23873.1| Ycf2 protein (chloroplast) [Olea europaea subsp.... 140 1e-33 ref|YP_004376463.1| Ycf2 protein [Olea europaea subsp. europaea]... 140 1e-33 gb|AVM38776.1| Ycf2 protein (chloroplast) [Fraxinus excelsior] >... 140 1e-33 ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans]... 140 1e-33 ref|YP_009366129.1| hypothetical chloroplast RF2 (plastid) [Scut... 140 1e-33 ref|YP_009183636.1| hypothetical chloroplast RF21 (chloroplast) ... 140 1e-33 >gb|OWK25792.1| hypothetical protein AJ87_01125 [Rhizobium yanglingense] Length = 207 Score = 132 bits (332), Expect = 3e-34 Identities = 66/71 (92%), Positives = 68/71 (95%), Gaps = 3/71 (4%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 246 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVN+LS ERCSTR Sbjct: 64 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNYLSRDCERCSTR 123 Query: 247 NILVIASTHIP 279 NILVIASTHIP Sbjct: 124 NILVIASTHIP 134 >ref|YP_009354249.1| ycf2 (chloroplast) [Rehmannia piasezkii] ref|YP_009354268.1| ycf2 (chloroplast) [Rehmannia piasezkii] gb|AQZ40735.1| ycf2 (chloroplast) [Rehmannia piasezkii] gb|AQZ40736.1| ycf2 (chloroplast) [Rehmannia piasezkii] Length = 2280 Score = 141 bits (356), Expect = 3e-34 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1714 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1773 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1774 VIASTHIP 1781 >ref|YP_009344480.1| ycf2 (chloroplast) [Rehmannia chingii] ref|YP_009344499.1| ycf2 (chloroplast) [Rehmannia chingii] ref|YP_009353986.1| ycf2 (chloroplast) [Rehmannia glutinosa] ref|YP_009354006.1| ycf2 (chloroplast) [Rehmannia glutinosa] ref|YP_009354074.1| ycf2 (chloroplast) [Rehmannia henryi] ref|YP_009354093.1| ycf2 (chloroplast) [Rehmannia henryi] ref|YP_009354161.1| ycf2 (chloroplast) [Rehmannia solanifolia] ref|YP_009354181.1| ycf2 (chloroplast) [Rehmannia solanifolia] ref|YP_009354336.1| ycf2 (chloroplast) [Rehmannia elata] ref|YP_009354355.1| ycf2 (chloroplast) [Rehmannia elata] gb|APT42232.1| ycf2 (chloroplast) [Rehmannia chingii] gb|APT42233.1| ycf2 (chloroplast) [Rehmannia chingii] gb|AQZ40472.1| ycf2 (chloroplast) [Rehmannia glutinosa] gb|AQZ40473.1| ycf2 (chloroplast) [Rehmannia glutinosa] gb|AQZ40560.1| ycf2 (chloroplast) [Rehmannia henryi] gb|AQZ40561.1| ycf2 (chloroplast) [Rehmannia henryi] gb|AQZ40647.1| ycf2 (chloroplast) [Rehmannia solanifolia] gb|AQZ40648.1| ycf2 (chloroplast) [Rehmannia solanifolia] gb|AQZ40822.1| ycf2 (chloroplast) [Rehmannia elata] gb|AQZ40823.1| ycf2 (chloroplast) [Rehmannia elata] Length = 2280 Score = 141 bits (356), Expect = 3e-34 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1714 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1773 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1774 VIASTHIP 1781 >gb|PHT68413.1| hypothetical protein T459_27900 [Capsicum annuum] Length = 137 Score = 129 bits (324), Expect = 7e-34 Identities = 65/71 (91%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 246 MMP+ID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESN LSLGLLVNHLS ERCSTR Sbjct: 67 MMPKIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNDLSLGLLVNHLSRDCERCSTR 126 Query: 247 NILVIASTHIP 279 NILVIASTHIP Sbjct: 127 NILVIASTHIP 137 >ref|YP_009462474.1| Ycf2 protein (chloroplast) [Syringa vulgaris] ref|YP_009462492.1| Ycf2 protein (chloroplast) [Syringa vulgaris] gb|AUT85325.1| Ycf2 protein (chloroplast) [Syringa vulgaris] gb|AUT85343.1| Ycf2 protein (chloroplast) [Syringa vulgaris] Length = 2162 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1596 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1655 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1656 VIASTHIP 1663 >ref|YP_009462210.1| Ycf2 protein (chloroplast) [Noronhia lowryi] ref|YP_009462230.1| Ycf2 protein (chloroplast) [Noronhia lowryi] gb|AUT84534.1| Ycf2 protein (chloroplast) [Noronhia lowryi] gb|AUT84554.1| Ycf2 protein (chloroplast) [Noronhia lowryi] Length = 2162 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1596 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1655 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1656 VIASTHIP 1663 >gb|AUT84358.1| Ycf2 protein (chloroplast) [Fraxinus ornus] gb|AUT84378.1| Ycf2 protein (chloroplast) [Fraxinus ornus] Length = 2162 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1596 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1655 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1656 VIASTHIP 1663 >gb|AUT84097.1| Ycf2 protein (chloroplast) [Fontanesia phillyreoides subsp. fortunei] gb|AUT84116.1| Ycf2 protein (chloroplast) [Fontanesia phillyreoides subsp. fortunei] Length = 2164 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1597 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1656 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1657 VIASTHIP 1664 >ref|YP_009462122.1| Ycf2 protein (chloroplast) [Nestegis apetala] ref|YP_009462142.1| Ycf2 protein (chloroplast) [Nestegis apetala] gb|AUT84446.1| Ycf2 protein (chloroplast) [Nestegis apetala] gb|AUT84466.1| Ycf2 protein (chloroplast) [Nestegis apetala] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_009462035.1| Ycf2 protein (chloroplast) [Forsythia x intermedia] ref|YP_009462054.1| Ycf2 protein (chloroplast) [Forsythia x intermedia] gb|AUT84272.1| Ycf2 protein (chloroplast) [Forsythia x intermedia] gb|AUT84291.1| Ycf2 protein (chloroplast) [Forsythia x intermedia] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_009461859.1| Ycf2 protein (chloroplast) [Chionanthus rupicola] ref|YP_009461879.1| Ycf2 protein (chloroplast) [Chionanthus rupicola] gb|AUT84009.1| Ycf2 protein (chloroplast) [Chionanthus rupicola] gb|AUT84029.1| Ycf2 protein (chloroplast) [Chionanthus rupicola] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_009461771.1| Ycf2 protein (chloroplast) [Chionanthus parkinsonii] ref|YP_009461791.1| Ycf2 protein (chloroplast) [Chionanthus parkinsonii] gb|AUT83921.1| Ycf2 protein (chloroplast) [Chionanthus parkinsonii] gb|AUT83941.1| Ycf2 protein (chloroplast) [Chionanthus parkinsonii] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_009110644.1| Ycf2 protein (chloroplast) [Hesperelaea palmeri] ref|YP_009110664.1| Ycf2 protein (chloroplast) [Hesperelaea palmeri] emb|CED79804.1| Ycf2 protein (chloroplast) [Hesperelaea palmeri] emb|CED79824.1| Ycf2 protein (chloroplast) [Hesperelaea palmeri] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_004564046.1| Ycf2 protein [Olea woodiana subsp. woodiana] ref|YP_004564066.1| Ycf2 protein [Olea woodiana subsp. woodiana] ref|YP_009462298.1| Ycf2 protein (chloroplast) [Olea exasperata] ref|YP_009462318.1| Ycf2 protein (chloroplast) [Olea exasperata] emb|CBS29394.1| Ycf2 protein (chloroplast) [Olea woodiana subsp. woodiana] emb|CBS29415.1| Ycf2 protein (chloroplast) [Olea woodiana subsp. woodiana] gb|AUT85149.1| Ycf2 protein (chloroplast) [Olea exasperata] gb|AUT85169.1| Ycf2 protein (chloroplast) [Olea exasperata] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >emb|CBR23873.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23893.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_004376463.1| Ycf2 protein [Olea europaea subsp. europaea] ref|YP_004376483.1| Ycf2 protein [Olea europaea subsp. europaea] ref|YP_004563823.1| Ycf2 protein [Olea europaea subsp. cuspidata] ref|YP_004563843.1| Ycf2 protein [Olea europaea subsp. cuspidata] ref|YP_004564539.1| Ycf2 protein [Olea europaea subsp. maroccana] ref|YP_004564559.1| Ycf2 protein [Olea europaea subsp. maroccana] emb|CBR30357.1| Ycf2 protein (plastid) [Olea europaea subsp. europaea] emb|CBR30377.1| Ycf2 protein (plastid) [Olea europaea subsp. europaea] emb|CBR24666.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] emb|CBR24687.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] emb|CBR30450.1| Ycf2 protein (plastid) [Olea europaea subsp. europaea] emb|CBR30471.1| Ycf2 protein (plastid) [Olea europaea subsp. europaea] emb|CBS29285.1| Ycf2 protein (chloroplast) [Olea europaea subsp. maroccana] emb|CBS29312.1| Ycf2 protein (chloroplast) [Olea europaea subsp. maroccana] emb|CBJ04340.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] emb|CBJ04360.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23781.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23801.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] emb|CCQ09144.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] emb|CCQ09164.1| Ycf2 prot (chloroplast) [Olea europaea subsp. europaea] gb|AUT84622.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84642.1| Ycf2 protein (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84709.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gb|AUT84729.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gb|AUT84798.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gb|AUT84818.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gb|AUT84886.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gb|AUT84906.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gb|AUT84974.1| Ycf2 protein (chloroplast) [Olea europaea subsp. guanchica] gb|AUT84994.1| Ycf2 protein (chloroplast) [Olea europaea subsp. guanchica] gb|AUT85062.1| Ycf2 protein (chloroplast) [Olea europaea subsp. laperrinei] gb|AUT85081.1| Ycf2 protein (chloroplast) [Olea europaea subsp. laperrinei] Length = 2165 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1659 VIASTHIP 1666 >gb|AVM38776.1| Ycf2 protein (chloroplast) [Fraxinus excelsior] gb|AVM38793.1| Ycf2 protein (chloroplast) [Fraxinus excelsior] Length = 2167 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1601 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1660 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1661 VIASTHIP 1668 >ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans] ref|YP_008964094.1| hypothetical chloroplast RF2 [Ajuga reptans] gb|AHA84954.1| hypothetical chloroplast RF2 (plastid) [Ajuga reptans] gb|AHA84961.1| hypothetical chloroplast RF2 (plastid) [Ajuga reptans] Length = 2248 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1685 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1744 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1745 VIASTHIP 1752 >ref|YP_009366129.1| hypothetical chloroplast RF2 (plastid) [Scutellaria lateriflora] ref|YP_009366147.1| hypothetical chloroplast RF2 (plastid) [Scutellaria lateriflora] gb|ARJ61585.1| hypothetical chloroplast RF2 (plastid) [Scutellaria lateriflora] gb|ARJ61586.1| hypothetical chloroplast RF2 (plastid) [Scutellaria lateriflora] Length = 2269 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1703 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1762 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1763 VIASTHIP 1770 >ref|YP_009183636.1| hypothetical chloroplast RF21 (chloroplast) [Scutellaria insignis] ref|YP_009183655.1| hypothetical chloroplast RF21 (chloroplast) [Scutellaria insignis] gb|ALN11646.1| hypothetical chloroplast RF21 (chloroplast) [Scutellaria insignis] gb|ALN11665.1| hypothetical chloroplast RF21 (chloroplast) [Scutellaria insignis] Length = 2271 Score = 140 bits (352), Expect = 1e-33 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 76 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 255 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1703 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1762 Query: 256 VIASTHIP 279 VIASTHIP Sbjct: 1763 VIASTHIP 1770