BLASTX nr result
ID: Rehmannia30_contig00009526
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00009526 (645 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16839.1| hypothetical protein CDL12_10493 [Handroanthus im... 62 2e-07 gb|PIN00275.1| hypothetical protein CDL12_27228 [Handroanthus im... 59 2e-06 ref|XP_011081715.1| LOW QUALITY PROTEIN: protein EARLY FLOWERING... 58 3e-06 ref|XP_022872053.1| protein EARLY FLOWERING 3-like [Olea europae... 58 4e-06 emb|CDP08210.1| unnamed protein product [Coffea canephora] 57 5e-06 >gb|PIN16839.1| hypothetical protein CDL12_10493 [Handroanthus impetiginosus] Length = 646 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 645 HRLIKVQRLIAESPHLLLEDSAYFDKPIKPLPVKKL 538 HRLIKVQ+LIAESPHLLLEDSAY +KP K LP KKL Sbjct: 309 HRLIKVQKLIAESPHLLLEDSAYLNKPSKALPRKKL 344 >gb|PIN00275.1| hypothetical protein CDL12_27228 [Handroanthus impetiginosus] Length = 671 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 645 HRLIKVQRLIAESPHLLLEDSAYFDKPIKPLPVKKL 538 HRLIKVQRLIA SPHLLLEDS Y KP+K LP KK+ Sbjct: 352 HRLIKVQRLIAASPHLLLEDSPYLRKPVKALPGKKI 387 >ref|XP_011081715.1| LOW QUALITY PROTEIN: protein EARLY FLOWERING 3 [Sesamum indicum] Length = 694 Score = 58.2 bits (139), Expect = 3e-06 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -1 Query: 645 HRLIKVQRLIAESPHLLLEDSAYFDKPIKPLPVKKLFVDCKEEK-NNVKRQE 493 HRLIKVQ+LI+ SPH+LLEDS Y KP+KPL KKL + C + NV +Q+ Sbjct: 356 HRLIKVQKLISASPHVLLEDSGYLGKPLKPLHGKKLPLGCAVKAIPNVSKQK 407 >ref|XP_022872053.1| protein EARLY FLOWERING 3-like [Olea europaea var. sylvestris] ref|XP_022872054.1| protein EARLY FLOWERING 3-like [Olea europaea var. sylvestris] ref|XP_022872055.1| protein EARLY FLOWERING 3-like [Olea europaea var. sylvestris] Length = 662 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 645 HRLIKVQRLIAESPHLLLEDSAYFDKPIKPLPVKKLFVD 529 HRL+KVQR IA SPHLLLED+AY KP+K LP +KL +D Sbjct: 340 HRLLKVQRSIAGSPHLLLEDAAYLGKPVKALPAEKLPLD 378 >emb|CDP08210.1| unnamed protein product [Coffea canephora] Length = 713 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 645 HRLIKVQRLIAESPHLLLEDSAYFDKPIKPLPVKKLFVD 529 HRLIKVQR+IA SPHLLLEDSAY KPIK KKL +D Sbjct: 367 HRLIKVQRMIAGSPHLLLEDSAYLGKPIKGSAPKKLPID 405