BLASTX nr result
ID: Rehmannia30_contig00009394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00009394 (677 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET07434.1| phytoene synthase, partial [Ipomoea batatas] 74 3e-13 gb|AIU48720.1| phytoene synthase, partial [Erythranthe guttata] 76 2e-12 ref|XP_012841552.1| PREDICTED: phytoene synthase 2, chloroplasti... 76 2e-12 gb|ALE33743.1| phytoene synthase 1 [Erythranthe lewisii] 76 2e-12 gb|AFK91527.1| phytoene synthase, partial [Beta vulgaris] 71 3e-12 gb|ADR51672.1| chloroplast phytoene synthase, partial [Catharant... 74 7e-12 gb|AFI09267.1| phytoene synthase, partial [Gardenia jasminoides] 71 8e-12 gb|ACI12954.1| phytoene synthase, partial [Manihot esculenta] 69 1e-11 ref|XP_019172386.1| PREDICTED: phytoene synthase 2, chloroplasti... 74 2e-11 gb|AGL44391.1| phytoene synthase [Ipomoea batatas] 74 2e-11 gb|AIY60805.1| phytoene synthase [Ipomoea batatas] 74 2e-11 ref|XP_022879717.1| phytoene synthase 2, chloroplastic [Olea eur... 73 2e-11 gb|AFK66771.1| phytoene synthase [Osmanthus fragrans] 73 2e-11 gb|PIA26678.1| hypothetical protein AQUCO_09100082v1 [Aquilegia ... 73 3e-11 ref|XP_021910865.1| phytoene synthase 2, chloroplastic-like [Car... 73 3e-11 gb|AMJ39471.1| phytoene synthase 1 [Bixa orellana] 73 3e-11 gb|AFH66948.1| chloroplast phytoene synthase, partial [Strelitzi... 67 4e-11 ref|XP_022894188.1| phytoene synthase 2, chloroplastic-like [Ole... 72 6e-11 dbj|BAI47572.1| phytoene synthase [Ipomoea sp. Kenyan] 72 6e-11 gb|PIN16050.1| Squalene synthetase [Handroanthus impetiginosus] 72 6e-11 >gb|AET07434.1| phytoene synthase, partial [Ipomoea batatas] Length = 117 Score = 73.6 bits (179), Expect = 3e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRARKFFD+AE GVTELS+ASRWPV Sbjct: 24 DKWRNFMKKQIKRARKFFDEAERGVTELSSASRWPV 59 >gb|AIU48720.1| phytoene synthase, partial [Erythranthe guttata] Length = 330 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQI RARKFFDDAESGVTELSAASRWPV Sbjct: 249 DKWRNFMKKQIARARKFFDDAESGVTELSAASRWPV 284 >ref|XP_012841552.1| PREDICTED: phytoene synthase 2, chloroplastic [Erythranthe guttata] ref|XP_012841553.1| PREDICTED: phytoene synthase 2, chloroplastic [Erythranthe guttata] gb|EYU33952.1| hypothetical protein MIMGU_mgv1a007168mg [Erythranthe guttata] Length = 416 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQI RARKFFDDAESGVTELSAASRWPV Sbjct: 322 DKWRNFMKKQIARARKFFDDAESGVTELSAASRWPV 357 >gb|ALE33743.1| phytoene synthase 1 [Erythranthe lewisii] Length = 417 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQI RARKFFDDAESGVTELSAASRWPV Sbjct: 323 DKWRNFMKKQIARARKFFDDAESGVTELSAASRWPV 358 >gb|AFK91527.1| phytoene synthase, partial [Beta vulgaris] Length = 107 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRAR FFD AE+GV+ELSAASRWPV Sbjct: 15 DKWRNFMKKQIKRARMFFDQAENGVSELSAASRWPV 50 >gb|ADR51672.1| chloroplast phytoene synthase, partial [Catharanthus roseus] Length = 379 Score = 74.3 bits (181), Expect = 7e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRARKFFD+AESGVT+LS+ASRWPV Sbjct: 333 DKWRNFMKKQIKRARKFFDEAESGVTQLSSASRWPV 368 >gb|AFI09267.1| phytoene synthase, partial [Gardenia jasminoides] Length = 167 Score = 71.2 bits (173), Expect = 8e-12 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNF+KKQIKRARKFFD+AE GVTEL++ASRWPV Sbjct: 110 DKWRNFVKKQIKRARKFFDEAEKGVTELNSASRWPV 145 >gb|ACI12954.1| phytoene synthase, partial [Manihot esculenta] Length = 98 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMK QIKRAR FF++AE GVTELSAASRWPV Sbjct: 36 DKWRNFMKNQIKRARMFFNEAEKGVTELSAASRWPV 71 >ref|XP_019172386.1| PREDICTED: phytoene synthase 2, chloroplastic [Ipomoea nil] Length = 438 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRARKFFD+AE GVTELS+ASRWPV Sbjct: 345 DKWRNFMKKQIKRARKFFDEAERGVTELSSASRWPV 380 >gb|AGL44391.1| phytoene synthase [Ipomoea batatas] Length = 438 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRARKFFD+AE GVTELS+ASRWPV Sbjct: 345 DKWRNFMKKQIKRARKFFDEAERGVTELSSASRWPV 380 >gb|AIY60805.1| phytoene synthase [Ipomoea batatas] Length = 438 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRARKFFD+AE GVTELS+ASRWPV Sbjct: 345 DKWRNFMKKQIKRARKFFDEAERGVTELSSASRWPV 380 >ref|XP_022879717.1| phytoene synthase 2, chloroplastic [Olea europaea var. sylvestris] Length = 438 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQI RARKFFDDAE GVTELS+ASRWPV Sbjct: 345 DKWRNFMKKQITRARKFFDDAEKGVTELSSASRWPV 380 >gb|AFK66771.1| phytoene synthase [Osmanthus fragrans] Length = 438 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQI RARKFFDDAE GVTELS+ASRWPV Sbjct: 345 DKWRNFMKKQITRARKFFDDAEKGVTELSSASRWPV 380 >gb|PIA26678.1| hypothetical protein AQUCO_09100082v1 [Aquilegia coerulea] Length = 378 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/46 (73%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPVRT-FSFNYLD 543 DKWRNFMK QIKRAR FFD+AE GVT+LS+ASRWPVRT + Y D Sbjct: 331 DKWRNFMKNQIKRARMFFDEAEKGVTQLSSASRWPVRTRIVYTYTD 376 >ref|XP_021910865.1| phytoene synthase 2, chloroplastic-like [Carica papaya] gb|ABG72805.1| phytoene synthase protein [Carica papaya] Length = 438 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRAR FFD+AE GVTELSAASRWPV Sbjct: 343 DKWRNFMKKQIKRARMFFDEAEKGVTELSAASRWPV 378 >gb|AMJ39471.1| phytoene synthase 1 [Bixa orellana] Length = 439 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRAR FFD+AE GVTELSAASRWPV Sbjct: 345 DKWRNFMKKQIKRARMFFDEAEKGVTELSAASRWPV 380 >gb|AFH66948.1| chloroplast phytoene synthase, partial [Strelitzia reginae] Length = 83 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWR+FMKKQIKRAR FF +AE+GVTELS ASRWPV Sbjct: 32 DKWRSFMKKQIKRARMFFQEAENGVTELSRASRWPV 67 >ref|XP_022894188.1| phytoene synthase 2, chloroplastic-like [Olea europaea var. sylvestris] Length = 438 Score = 72.0 bits (175), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQI RARKFFDDAE GVT+LS+ASRWPV Sbjct: 345 DKWRNFMKKQITRARKFFDDAEKGVTQLSSASRWPV 380 >dbj|BAI47572.1| phytoene synthase [Ipomoea sp. Kenyan] Length = 439 Score = 72.0 bits (175), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRARKFFD+AE GVTEL +ASRWPV Sbjct: 346 DKWRNFMKKQIKRARKFFDEAERGVTELGSASRWPV 381 >gb|PIN16050.1| Squalene synthetase [Handroanthus impetiginosus] Length = 440 Score = 72.0 bits (175), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 677 DKWRNFMKKQIKRARKFFDDAESGVTELSAASRWPV 570 DKWRNFMKKQIKRAR FFDDA+ GVTELS+ASRWPV Sbjct: 346 DKWRNFMKKQIKRARTFFDDAQKGVTELSSASRWPV 381