BLASTX nr result
ID: Rehmannia30_contig00007973
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00007973 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22882.1| hypothetical protein CDL12_04399 [Handroanthus im... 73 3e-14 >gb|PIN22882.1| hypothetical protein CDL12_04399 [Handroanthus impetiginosus] Length = 81 Score = 73.2 bits (178), Expect = 3e-14 Identities = 37/54 (68%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = -3 Query: 224 MDCSLLTIVVGLWFILDLAL--GFDVAYRWFSFSDYLSLDGNFCCVCLPVGTYS 69 M CS + VGLWF+L+L+L GFDVAYRWF+FSDYLSLDGN VCLP+ TYS Sbjct: 1 MACSHFMLGVGLWFMLELSLACGFDVAYRWFNFSDYLSLDGNL-RVCLPLWTYS 53